skillindiajobs
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Market Research Analyst

2.00 to 7.00 Years   Mumbai City   26 Dec, 2020
Job LocationMumbai City
EducationNot Mentioned
SalaryNot Disclosed
IndustryIT - Software
Functional AreaMarket Research (MR)
EmploymentTypeFull-time

Job Description

Market Research AnalystExperience : 1 2 YrsResponsible for doing research on an assigned topic, and providing analysis and reporting. While the domain of knowledge will vary greatly across industries, a research associate will typically be responsible for the research and collection of information, analysis of that information given a project s expressed goals and presentation of findings/ results to help inform decisions on a project or within an organization. Responsibilities: The Research Analyst will be completely responsible for doing research, collection of information, analysis and summation to help the Incubation Manager to achieve the organizations objectives. The Research Analyst is expected to have a keen attention to detail, analytical and should recommend actions based upon the gathered data/ facts. Major responsibility would be inclusive of the following: Research market and industry trends and patterns related to new technology. Industries and sectors using these new technologies. Create detailed reports of findings and convert complex data and findings into understandable tables, graphs, and written reports, simplify findings into presentations. Organize, Compile and store data for future use. Document all data and research procedures. Analyze data and information to find ways to improve operations, pin point problems and solutions, Inform and advise various levels of management and stakeholders. Recommend changes and improvements based on research findings. Meet with Start- ups and vendors to discuss procedures, processes, develop and conduct surveys. Create master data. Analyze habits and data available from competitors. Compare ROI with past numbers. Implement tests of processes, policies, and protocols. Identify and understand problems through forecasting, gap analysis, quantitative reporting, research, and statistical analysis. Write reports, white papers, and other published documents. If the position is fit for your skill set please apply this job. A visitor from 3 mins ago Navi mumbai, Maharashtra 7 mins ago 36 mins ago Mumbai, Mumbai suburban 40 mins ago Jabalpur, Madhya pradesh 45 mins ago 46 mins ago 49 mins ago Hyderabad, Andhra pradesh 1 hr 19 mins ago New delhi, Delhi 1 hr 40 mins ago 2 hrs 18 mins ago Registration for Trainer/ Consultant Change Name Email transcript Sound On Sound Off Pop out widget End this chat session Please fill out the form below and we will get back to you as soon as possible. Sorry, file transfer is limited to 5 files at a time. Please try the following file(s) again : Sorry, file transfer is limited to 50mb per file. Please compress the following file(s) and try again.,

Keyskills :
roiresearchtestssalespopemailchatgapmarketingfitwhite papersfile transfersecondary researchresearch analysismarket researchgap analysis

Market Research Analyst Related Jobs

© 2020 Skillindia All Rights Reserved