Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
At Xicom, we believe in offering much more than just a job. We strive to give you a full - fledged growing career driven with passion. Senior Project Manager Experience: 6 - 8 Years Experience: B.Tec...
javaagileproject managementcustomer relationsmobile applicationsproject management softwareconflict resolutionms projectteam buildingAt Xicom, we believe in offering much more than just a job. We strive to give you a full - fledged growing career driven with passion. Experience: 3 - 5 Years Experience: B.Tech / MCA Responsibilitie...
functionaldocumentationrequirementschange controlmedia entertainmentfunctional specificationsfile transferbusiness analysisbusiness processcustomer relationscommunication skillsbusiness requirementsBusiness Development Executive Location: Gurgaon Department: Business Development Business Development Manager (IT) with minimum 2 to 4 years of Experience in dealing with international clients to g...
salesmarketingcustomer relationsbusiness developmentcold callingfile transferonline biddingemail marketingweb developmentproblem solvingclient accountsquality standardsleadership skillsbusiness expansiShould have strong experience on Java, Core Java, Advanced Java, Angular, Boot Starp, HTML, CSS, Hibernate, Struts. Candidates having PHP Knowledge is advantage for us If the position is fit for y...
javamysqljsphibernatespringadvanced javafile transferphpcsssetpopfithtmlchatemailsoundmessagingconsultinge javaBDE Corporate Sales - Convey Tech Labs BDE Corporate Sales No.of openings : 1 Experience : 1 2 Yrs Should have good communication skills, proactive and zeal to do the work Must have experience in...
social media marketingentry levelsocial mediafile transferlead generationmedia marketingsales managementbusiness meetingscommunication skillssetpopsales suppate salessales netwkingMarket Research Analyst Experience : 1 2 Yrs Responsible for doing research on an assigned topic, and providing analysis and reporting. While the domain of knowledge will vary greatly across indus...
roiresearchtestssalespopemailchatgapmarketingfitwhite papersfile transfersecondary researchresearch analysismarket researchgap analysisWe are looking for a Software Generalist with 2+ years experience programming with Javascript or similar language. If you are a results driven coder who gets high from seeing her / his applications ma...
google suitelead generationinside salesmedia marketingsocial media marketingsocial mediasales leadsgoogle apps scriptcloud salesgoogle appsfile transferpost salesdesign briefsonline marketingdigital marketingit infrastructurerevenue generaJobs - Software Developer in visionpix.in Job - Software Developer Skills : Net technology 3.5 and above (C#, .Net Win Forms and VB.Net, ADO.Net), Web Services, LINQ, Xml, Web Services Education : B...
sql serverjavascriptjqueryhtmlsqlweb servicesfile transferxmlnetwinotpnetlinqemailvbnetsoftwareeducationwinfAge Limit : 28 Diploma ME M/ F: M Exp: 0 - 1 Years Salary: 11, 400 + PF + ESIC + Free Accomodation Full Time Posted 1 days ago Job Summary Company : Packaging Company (Off Roll) Location : Dhul...
etpfire fightingmechanicalplcsecesiccaresaltlakesalaryresumepackagingApplicationsPersonal StatementsExecutive BiosEmployer Engagementair compressWelfaretowCertified Professional ResumeJobs - Android Developer in visionpix.in Job - Android Developer Skills : Skill set : Translaterequirements and implement product features to perfection using Android technology stack. Excellen...
androidjavajsonapicomcode designfile transferdata structuresdesign patternsprogramming conceptsrestful apissetotpcloudbasicemaildesignreviewsageJobs - Dot Net Developer in visionpix.in Job - Dot Net Developer Skills : Required skills Graduation/ Post- graduation(Engineering graduate preferred) At least 5 years experiencein software devel...
sql servernetjqueryjavascripthtmlcreative problem solvingweb servicesfile transferproblem solvingdependency injectionarchitectural patternssqlnetapidototpsoapemailtestsentity framew3. Maintenance & Utility Manager : (1) The Candidate Must Be Mechanical Engineer Having 10 to 12 Years Experience in Edible Oil Industry Or Similar Industry and Having Knowledge Of High Pressure Boil...
commissioningwater treatment plantcomplianceairedible oiloil industryhigh pressureammoniapressuremechanicalautomationabsmaintenanceSunflowerFatty AcidsOleochemicalsOilsair compressptioncompressProcurement Engineers: 2- 6 years of experience in EPC project procurement Experience in procurement of seamless and ERW pipes Experience in procuring valves, pumps, compressors etc Good negoti...
procurementnegotiationpurchasedeliverymaterials managementepc projectnegotiation skillsproject procurementcommunication skillsepcpumpspipesvalvescommunicationInternational SalesBusiness PlanningcompressWordpress Backend Developer - Web Design and Development Company | UI & UX Development Wordpress Backend Developer WORDPRESS BACKEND DEVELOPER We are looking for an experienced Software Engineer to j...
javajavascriptsqljqueryunit testingapplication architecturestored proceduresangular jsext jsfile transferorganization skillscore phpsql serverweb applicationsweb applicationjavascript librariesCreative Web Designer - Web Design and Development Company | UI & UX Development Creative Web Designer CREATIVE WEB DESIGNER We are looking for an experienced User Interface Designer to join our pass...
htmljavascriptcssphotoshopjqueryfile transfermobile devicesweb applicationsdesign patternsuser interface designsound editinguser experience designvisual designafter effectsuser experience3d modelingFront End Software Engineer - Web Design and Development Company | UI & UX Development Front End Software Engineer FRONT END SOFTWARE ENGINEER We are looking for an experienced Front end software eng...
designresearchuser experience designstored proceduresfront endvisual designfile transfermobile devicesexperiencecore phpweb applicationshpuxuser interface designuser experiencecustomer relationsWe are looking for a Receptionist to be responsible for greeting clients and visitors to our office, manage our front desk on a daily basis and to perform a variety of administrative tasks. Role & Re...
ms officefront deskfile transfercustomer servicecommunication skillsverbal communicationoperational requirementspopchatemailsoundsalaryfilingcouriermessagingoperationsstationerycharacterscommunicationAssociate Business Analyst - Internship - Faveo Helpdesk Software Associate Business Analyst Internship Overview We are looking for interns to join our customer relationship department. A three- mon...
customer relationshipclient managementbusiness analysisrelationship managementservice deliveryaccount managementproject administrationclient retentionRelationship Manager - Internship - Faveo Helpdesk Software Relationship Manager Internship Overview This opening is for freshers with awesome communication and interpersonal skills. An opportunity ...
insurancebankingmarketingchatsalesmanagement skillscustomer relationsaccount managementmusic makingkey accountsclient retentioncommunication skillsservice deliveryfile transfervideverbal communicationUI/ UX Internship - Faveo Helpdesk Software UI/ UX Internship Overview A three month programme will welcome you in the world of web development where you would be learning to develop informative, cr...
web developmentphpadobe photoshopinformation technologyxhtmlcomputer scienceadobehtmlgraphic designEstablish and carry out departmental or organizational goals , policies , and procedures Direct and oversee an organization s financial and budgetary activities Manage general activities related t...
marketingsalesmisaccountshuman resourcesfile transfergeneral activitiesgeneral operationsfinancial statementspopchatemailsoundresumecontractsmessagingoperationsagreementsindicatto learn more and see how we can help you. AJAYA KUMAR SAHOO Head of communication Engineering and Media Monthly Newsletter Change Name Email transcript Sound On Sound Off Pop out widget ...
customer relationsresearchdesignfile transferpopchatemailsoundmessagingcharactersengineeringManaged File TransferAsperaFTPSConnect DirectSecure FTPNDMhpuxSterling IntegratA DevOps role in most organizations requires experience with integration technology , automation and cloud coding languages. This experience can be gained by Systems Managers , IT Project Managers or ...
agile project managementopen sourcefile transferproject managersproject managementcontinuous integrationpopchatcloudagileemailsounddevopsresumewritingcontroldatabaseLead and manage the Corporate sales team of the organization for Sandeshlive.com(Communication product of VasTECH widely used in the market). Provision of efficient and effective services to the Vaste...
strong interpersonal skillsfile transferinsurance salesbusiness developmentcommunication skillsinterpersonal skillserppopchatsalesemailsoundclosurebusinessinsuranceate salessales netwking5 days in a week (Every Sat- Sun off) Skillset: Profound insight of JavaScript and Node.js internals including building public node (npm) modules Deep understanding of JS best- practices (security...
sqlgitfile transferdatabase modelingeuropean works councilsapi developmentaudio masteringcommercial modelsprofessional liabilitysatisfactioncontinuous improvementMinimum 6 Months. PHP/ Wordpress Developer - TechInfini Solutions Pvt. Ltd.TechInfini Solutions Pvt. Ltd. Chat - Offline Agent List Please fill out the form below and we will get back to you as soon ...
wordpressmysqlhtmlcssphpfile transferchatvideoemailsoundManaged File TransferAsperaFTPSConnect DirectSecure FTPSterling IntegratorNDMSecure File Transfer ProtocolPretty Good PrivacyWeb Chat1.Marketing Executive Marketing executives are involved in developing marketing campaigns to promote a product, service or idea. The role includes planning, advertising, public relations, organising ...
advertisingmarketingsalesbusiness developmentcustomer relationsproduct developmentfile transferinternet marketingsearch enginebulk smssearch engine optimization
UI/ UX Designer Back to All Positions Position - UI/ UX Designer Person who has creativity & logic how things should work along with how beautiful it can be. Work Experience 2- 3 Years of work exper...
customer relationsresearchdesignuser researchfile transferoptimization strategiesfitphotoshoppresentationcommunicationContextual InquiryCard SortingHeuristic EvaluationUser ScenarioshpuxPaper PrThis box is for spam protection - please leave it blank: Signup for Hosting Select Hosting Plan Subscription Type Prefer Mode of Payment Credit Card / Debit Card Direct Bank Transfer Cheque/ DD Payp...
marketingsalescustomer relationsbusiness developmentadvertisingweb hostingfile transferpaypal integrationproject administrationvideoemailsounddesigncreditmagentoopeningslicensingprestashopvalidation5 days in a week (Every Sat- Sun off) Skillset: Profound insight of JavaScript and Node.js internals including building public node (npm) modules Deep understanding of JS best- practices (security...
sqlgitfile transferdatabase modelingeuropean works councilsapi developmentaudio masteringcommercial modelsprofessional liabilitysatisfactioncontinuous improvementGrow Your Career With Q - Manager | Queue Management Tools| Career Please fill out the form below and we will get back to you as soon as possible. maximum_file_upload_warning Warning : Sorry , file tr...
adobe creative suiteresearchdevelopmentms officeit hardwareit servicessocial mediacopy editingnew businesswhite paperssearch enginefile transferemail marketingbrand awarenesstime managementsuccess storiescustomer serviceonline marketingGrow Your Career With Q- Manager | Queue Management Tools| Career Open positions in Queue Manager Please fill out the form below and we will get back to you as soon as possible. Warning : Sorry, file...
salesmarketingtargetretailbusiness developmentadobe creative suiteresearchdevelopmentcustomer relationship managementit hardwareit servicessocial mediacopy editingnew businesswhite paperssearch enginefile transferemail marketingbrand awa© 2020 Skillindia All Rights Reserved