test cases jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

test cases Job Openings

Showing 0 - 50 of 50826 Jobs

Manager, Data Analysis

Standard Chartered Bank Ltd 8.00 to 12.00 Years Mumbai City 05 Jul, 2022

Responsible for end to end functional requirements gathering from sourcing to consumption of data from various source systems related to CFCC domain
Analyse data available fr...
environmental impact assessmentkeeping things simpletest cases

Required for _Senior Analyst-FCSO

Standard Chartered Bank Ltd 4.00 to 5.00 Years Mumbai City 05 Jul, 2022

About Standard Chartered

Urgent Hiring for Java Tech Lead - Pan India

Larsen & Toubro Infotech Limited 8.00 to 13.00 Years Chennai, Noida, Hyderabad, Kolkata 05 Jul, 2022

Java Lead

Must Have

Good to have

microservices

azure

java

Lead Development

Standard Chartered Bank Ltd 3.00 to 8.00 Years Mumbai City 05 Jul, 2022

About Standard Chartered

software engineering practices

Senior Manager finance

Standard Chartered Bank Ltd 5.00 to 10.00 Years Mumbai City 05 Jul, 2022

About Standard Chartered

keeping things simple

Business Analyst, Liquidity

Standard Chartered Bank Ltd 5.00 to 8.00 Years Mumbai City 05 Jul, 2022

About Standard Chartered

requirements

documentation

business requirements

customer relations

functional

Analyst, Software Delivery & Release

Standard Chartered Bank Ltd 4.00 to 6.00 Years Mumbai City 05 Jul, 2022

About Standard Chartered

keeping things simple

web logic

Analyst- Software Delivery & Release Cyber Shikshaa

Standard Chartered Bank Ltd 4.00 to 6.00 Years Mumbai City 05 Jul, 2022

About Standard Chartered

web logic

script language

keeping things simple

board of directors

life insurance

human skills

Senior Officer customer service

Standard Chartered Bank Ltd 3.00 to 6.00 Years Mumbai City 05 Jul, 2022

The Role Responsibilities

Source client data from Internet. Intranet and bespoke data providers/GAM/CCMG teams as required.
Customized research activity needs to be ...
human skillskeeping things simplemisaccountscustomer servicebanking

Huge Recruiting for the post of Specialist, Financial Crime Surveillance Unit

Standard Chartered Bank Ltd 4.00 to 5.00 Years Mumbai City 05 Jul, 2022

About Standard Chartered

life insurance

new business

financial markets

correspondent banking

senior management

keeping things simple

human skills

crime prevention

retirement savings

Manager Counterparty Credit Risk, Stress Testing

Standard Chartered Bank Ltd 6.00 to 11.00 Years Mumbai City 05 Jul, 2022

About Standard Chartered

enterprise risk management

stress test

keeping things simple

credit risk

Associate Manager, GBS CPM OR

Standard Chartered Bank Ltd 5.00 to 10.00 Years Mumbai City 05 Jul, 2022

The purpose of RP is to assist Country Process Owners (CPOs) and Global Process Owner (GPOs) to effectively manage operational risk within the first line of defence. The members must ens...
customer relationsqualitymiskeeping things simplemanagementsales

Require for the AWS Architecture Application Developer

Accenture 15.00 to 18.00 Years Mumbai City 05 Jul, 2022

About Accenture:

Require for the Portfolio Manager, Supply Chain Finance

Standard Chartered Bank Ltd 4.00 to 0.00 Years Mumbai City 05 Jul, 2022

About Standard Chartered

keeping things simple

marketing

Manager, IT Resilience

Standard Chartered Bank Ltd 5.00 to 10.00 Years Mumbai City 05 Jul, 2022

Role Responsibilities

Job Summary*

Define key responsibilities

to reflect the duties and responsibilities of this role.

code of conduct

keeping things simple

service level management

Analyst-Clinical Data Management (CDM)

Accenture 3.00 to 5.00 Years Mumbai City 05 Jul, 2022

Skill required: Clinical Data Management (CDM) - Study Build

Designation: Analyst

Job Location: Mumbai

Qu...
case report formsroot cause analysisclinical data managementsubject matter expertisetest casesroot causeunit testingtest scriptsmusic making

EDS Coordinator I
Ranhill WorleyParsons 2.00 to 4.00 Years Mumbai City 05 Jul, 2022

* 48,000 people. 49 countries. Over 120 office locations. We re not just engineers. We re a global team of data scientists, consultants, construction workers and...
equal employment opportunityequipment supplybackground checksstepagilevisitplanetchecksclimateequalityscientistsconstructioncompensation

We are looking for SAP Fiori/UI5 & Responsive Design Architecture Application Developer
Accenture 6.00 to 8.00 Years Mumbai City 05 Jul, 2022

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
javajavascriptsqlcustomer relationshtmlsap bwsap bosap bpcsap hanabreak fixflat filesdata modeling

Urgent opening for Business Analyst at Borivali
Quastech 3.00 to 4.00 Years Mumbai City 05 Jul, 2022

Dear Candidate, Kindly see below mentioned JD for your reference- JD Name: Business Analyst Job Title: Business Analyst business analyticsbusiness analysis

Squad Lead, AIML Product
Standard Chartered Bank Ltd 4.00 to 10.00 Years Mumbai City 05 Jul, 2022

* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about...
blue skydeep learningcomputer sciencemachine learningmodel validationdata preparationfinancial marketsunstructured datasystems engineeringinformation systems

Java Developer
Webmobril Staffing Solutions LLP 7.00 to 9.00 Years Pune, Mumbai City 05 Jul, 2022

AWS and Angular skill set must Responsibilities Understand requirement and translate that to product features. Participate in Scrum meetings and express the work done and the plan clearly. Par...
javaspring frameworkmicroservicesaws

Applicants apply for Microsoft SQL Server Database Administration Cloud Platform Engineer
Accenture 2.00 to 4.00 Years Kolkata 05 Jul, 2022

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
javacssdanishformsgatewayms sql serverms sqlsql serversql queriesproblem solvingcapacity planning

Applicants apply for SAP ABAP Development for HANA Software Development Engineer
Accenture 4.00 to 6.00 Years Kolkata 05 Jul, 2022

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
javascriptjavamysqlhtmlapistrong analytical skillsmanage client expectationsstrong interpersonal skillsmaster dataunit testing

SAP BusinessObjects Data Services Application Developer
Accenture 6.00 to 8.00 Years Kolkata 05 Jul, 2022

Project Role :Application Developer

Project Role Description :Design, build and configure applications to meet business process and app...
javajavascriptsqlcustomer relationshtmldata servicesdata migrationbusiness objectstechnical designbusiness processsap applications

We are hiring for - Vmware Virtualization Administration Cloud Platform Engineer
Accenture 1.00 to 8.00 Years Kolkata 05 Jul, 2022

Project Role :Cloud Platform Engineer

Project Role Description :Designs, builds, tests, and deploys cloud application solutions that in...
javacssdanishformsgatewaydata centerhealth checkprivate cloudwindows servervmware vspherewriting skillsproblem solving

RPA Developer (Automation Anywhere /UIPath)
Larsen & Toubro Infotech Limited 4.00 to 9.00 Years Chennai, Hyderabad, Gurugram, Kolkata 05 Jul, 2022

Role - RPA Developer (Automation Anywhere/UIPATH) Good hands on experience in AA/UiPath toolsets Experience level 3-6 years Experience in analyzing business processes to suggest improvements and...
automationuipathrpaanywhereanywhere/uipath

Lead Consultant - EPM PBCS / EPBCS
Genpact India Pvt Ltd 3.00 to 6.00 Years Kolkata 05 Jul, 2022

Experience in implementation of Hyperion Planning & Essbase and/or Oracle PBCS, Oracle EPBCS solutions Project experience in EPM Suite of Products 11.x and/or Oracle PBCS, Oracle EPBCS Experi...
sapenvironmentdeliverycustomer relationssalescost benefit analysishandle multiple projectshyperion financial reporting

Req. for SAP ABAP
Accenture 6.00 to 8.00 Years Kolkata 05 Jul, 2022

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
javajavascriptsqlcustomer relationshtmlsap abaptest scriptsproblem solvingbusiness processissue resolutionproduction supportdatabase migration

Hardware And Networking Engineer
Ahlawat Consultancy Services Hiring For ahlawat services 0.00 to 1.00 Years Raipur, Kolkata, Pune, Bhavnagar 05 Jul, 2022

Dear Candidates, Kindly Read the Job Description Network Technician Responsibilities Include: Designing and installing well-functioning computer networks, connections and cabling Performing ...
hardware networkinghardware testingmanual testinghardware developmenthardware engineers

Desktop Support Engineer
Ahlawat Consultancy Services Hiring For Tata Projects Limited 0.00 to 1.00 Years Kanpur, Raipur, Lucknow, Kolkata 05 Jul, 2022

Dear Candidates, Kindly Read the Job Description Network Technician Responsibilities Include: Designing and installing well-functioning computer networks, connections and cabling Performing ...
networkingswitchinghardware networkingdesktop engineering

Database Administrator
ARYAN TECHNOLOGY 0.00 to 4.00 Years Noida, Chennai, Hyderabad, Kolkata 05 Jul, 2022

Responsibilities As a database administrator, youll need to:

establish the needs of users and monitor user access and security

monitor performance a...
oracleoracle streamssqlpl/sqloracle dba

openings for hiring dot net core developers in
Disha Consultant 3.00 to 6.00 Years Jaipur 05 Jul, 2022

Hiring Dot Net Core Developers For Bangalore, Chennai And Jaipur Bangalore, Jaipur Job Description We are seeking a .NET Core developer responsible for building .NET applications using C#, ASP....
collaborative problem solvingfront enduse casessql serverproblem solvingweb applicationtechnical analysisproduct developmentproject administrationapplication programmingautomated testingmicrosoft sqlsqlnetapiwcfdot

role forJava / .Net / Oracle Plsql / Mainframe / Angular / Devops Developer
Infosys Limited 0.00 to 9.00 Years Indore 05 Jul, 2022

A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to ensure effective Design, Development, Validation and Support activities, to assure that our cl...
test casesproblem solvingquality processesclient requirementsagile methodologiesdigital transformationperformance engineeringfitjavanetsdlcagilebasicoracle

Application support executive opening for Ahmedabad location for Night shift.
Intact Search 0.00 to 3.00 Years Indore, Jodhpur, Ratnagiri, Ujjain 05 Jul, 2022

Dear Candidate, Greetings of the day! We are looking for Tech Support at Ahmedabad with E-Clinical Works (US Based IT Company) Kindly go through the above JD and company link Profile :- Tech ...
ddlapplication supporttechnical supportddlcproduction support

Java Backend Developer
TEKsystems, Inc 6.00 to 10.00 Years Hyderabad 05 Jul, 2022

AddThis Sharing Buttons Share to Facebook Facebook Facebook AddThis Sharing Buttons Share to Twitter Twitter Twitter AddThis Sharing Buttons Share to Email Email Email Job Snapshot mysqljavascriptcssapihtmltest casescomputer sciencespring frameworkjavacloudazureemailjunitspringbackendwritingtwitterscienceopenshift

Opening for Jr. Customer Service Exec - Service Assurance
Tata Communications Ltd 2.00 to 3.00 Years Hyderabad 05 Jul, 2022

Job Family Descriptor Responsible for the equipments operation and maintenance (Fault, configuration, alarm, performance and security) or network components to drive network efficiency and...
customer servicesalesmisaccounts

We have opening for Lead - Service Assurance
Tata Communications Ltd 4.00 to 6.00 Years Hyderabad 05 Jul, 2022

Job Family Descriptor Responsible for the equipments operation and maintenance (Fault, configuration, alarm, performance and security) or network components to drive network efficiency and...
Information TechnologyChange ManagementTechnical SupportTechnologyManagement

Pegasystems Platform Application Developer
Accenture 4.00 to 5.00 Years Hyderabad 05 Jul, 2022

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
javajavascriptsqlcustomer relationshtmltest casesbusiness processsoftware developmentprofessional servicesagile scrumpegasoapprpccloudagilescrumvisitmobile

Technology Analyst
Infosys Limited 0.00 to 2.00 Years Hyderabad 05 Jul, 2022

A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to ensure effective Design, Development, Validation and Support activities, to assure that our cl...
javasqlunixcustomer relationssql servertest casesprogress 4glproblem solvingquality processesclient requirementsagile methodologiesdigital transformationperformance engineering4glfit

Opening role for Microsoft Azure PaaS Application Developer
Accenture 2.00 to 8.00 Years Hyderabad 05 Jul, 2022

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
javajavascriptsqlcustomer relationshtmlproject planscloud computingweb applicationtechnical designentity frameworkbusiness processexternal clients

Ios Developer For Spaze It Park Gurgaon.
Capital Placement Services 3.00 to 10.00 Years Gurugram 05 Jul, 2022

Job Responsibilities: Design and build advanced applications for the iOS platform Collaborate with cross-functional teams to define, design, and ship new features. For robustness, including e...
swiftiosxcodeobjective cjsoncore datacore graphicscore animationios developmentmobile developmentworking experienceapplication developmentbug fixingedgelesscocoadesignsalary

Software Developer For 5 Day Working US Based MNC
Capital Placement Services 2.00 to 6.00 Years Gurugram 05 Jul, 2022

Proven Experience as a Software Developer, experience with Software Design and Development in a Test-driven Environment .knowledge of Coding Languages. experience with With Databases. c#,.net...
jquerysqlnetdesignjavascripthtmlmaintenancesoftwaresoftware designms sql serversql server reportingms sqlsql serversql server 2008application programmingsoftware development

Technical Manager
Capital Placement Services 5.00 to 8.00 Years Gurugram 05 Jul, 2022

1. Deeply Understand Welch Products (analytical Hplc Columns, Prep Columns, Spe, Filters, Vails and Gc Columns Etc.) 2. Method Development in the Lab By Using Welch Products. 3. Will Be Respon...
javaagileproject managementcustomer relationsmethod development

AWS BigData Application Developer
Accenture 4.00 to 6.00 Years Gurugram 05 Jul, 2022

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
javajavascriptsqlhtmlsource system analysisdata solutionscloud computingdata processingbusiness processdata engineeringprofessional servicesbusiness requirementsapiawsemrgluecloudvisit

Opening position for Quality Assurance Engineering
Fiserv India Pvt Ltd 1.00 to 3.00 Years Noida 05 Jul, 2022

Experience -5 + Noida Location 15-20 Days Joiner Manual Mobile and Web testing - Must Automation using C#/Java (good to have with Appium/Selenium) Must ,
...
web testingmobiletestingTest EstimationCompatibility TestingExploratory TestingGUI TestingTesting ToolsRisk Based TestingEndtoend TestingNonfunctional Testing

Opening position for Assistant Manager - Legal - 13001
Tata Communications Ltd 2.00 to 5.00 Years Delhi 05 Jul, 2022

This group of positions is responsible for the delivery and administration of legal services to ensure the issues of risk and governance within the business are aligned to corporate goals. Assess ...
salesmisaccountstat

Huge Openings BIG DATA DEVELOPER-PAN INDIA -Leading Client Gurugram
Quess IT Staffing 4.00 to 8.00 Years Gurugram 05 Jul, 2022

WE have Multiple urgent openings with one of our Leading Client Role - BIG DATA DEVELOPER Exp. Required - 4-8+ Years Skills Required :- Hadoop, Pyspark, Spark, Scala AWS / API Development Expe...
awshadoopscala

We are looking for - SAP FI CO Finance Application Developer
Accenture 8.00 to 10.00 Years Gurugram 05 Jul, 2022

Project Role :Application Developer

Project Role Description :Design, build and configure applications to meet business process and app...
javajavascriptsqlcustomer relationshtmlnew glfixed assetstest scriptsbusiness processworking experiencerequirement gathering

Apply for the Solution Specialist
Nokia Solutions and Networks India Pvt Ltd 5.00 to 8.00 Years Noida 05 Jul, 2022

About Nokia (The below company introduction text should not be edited; remove this observation once having finalized the job description) At Nokia we create the technology to c...
salestargettelecomconsultingcoreend to end solutionsoperating acore networkversion controlglobal servicesnetwork servicesproject managersservice providers

Opening role for ABAP Development Application Developer
Accenture 1.00 to 6.00 Years Noida 05 Jul, 2022

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
javajavascriptsqlcustomer relationshtmlsap eccsap abapsap fioritest scriptsproblem solvingbusiness process

NEXT

test cases Job Openings

Responsibilities As a database administrator, youll need to: establish the needs of users and monitor user access and security monitor performance a... oracleoracle streamssqlpl/sqloracle dba

Job Family Descriptor Responsible for the equipments operation and maintenance (Fault, configuration, alarm, performance and security) or network components to drive network efficiency and... customer servicesalesmisaccounts

Job Family Descriptor Responsible for the equipments operation and maintenance (Fault, configuration, alarm, performance and security) or network components to drive network efficiency and... Information TechnologyChange ManagementTechnical SupportTechnologyManagement

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Responsibilities As a database administrator, youll need to:

establish the needs of users and monitor user access and security

monitor performance a...
oracleoracle streamssqlpl/sqloracle dba

Job Family Descriptor Responsible for the equipments operation and maintenance (Fault, configuration, alarm, performance and security) or network components to drive network efficiency and...
customer servicesalesmisaccounts

Job Family Descriptor Responsible for the equipments operation and maintenance (Fault, configuration, alarm, performance and security) or network components to drive network efficiency and...
Information TechnologyChange ManagementTechnical SupportTechnologyManagement