Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Digital Transformation Solutions Architect iSMAC , social , mobility , IOT , analytics , cloud Presales , Bangalore 12+ Year,...
iotcloudpresalesanalyticsDigital TrendsDigital EconomyDigital ChannelsDigital Servicesdigital transfmationtransfmationOperational TransfmationSourcing AdvisBusiness Model TransfmationCustomer ExpeCategory Electrical Engineer Positions 2 Qualification B.E./ M.E Specialization Electrical Engineering Experience 5 to 10 Years Work Place Bangalore Role Design of Power Projects and EHV Switch Yards....
merscommissioningsafetytroubleshootinglightingpower projectselectrical engineeringdesignengineeringPower Project DevelopmentHRSGBOPCombined CycleThermal Power PlantHydroelectricTransmission LinestransfHydSid Jobs Consultancy Pvt. Ltd Job Title :Internal Auditor Experience:2Yrs Job Location:Mumbai Job Description 2+ Year experience as Internal Auditor into BFSI Domain Salary up to 10Lacs Educat...
accountsaccountinginternal auditauditingverificationsidltdbfsisalaryeducationconsultancyCOSOSAS70External AuditIIA StandardsITGCAssuranceStatuty AuditCOSO FramewInternal Audit TransfmationRoles and Responsibilities Required Experience: 3 to 8 Years Skills :Dot net, asp.net, C#, Framework, design Job Description Job Functions/Duties and Responsibilities: Design and...
working experienceagile developmentunit testingcustomer experiencedata engineeringglobal bankingtest driven developmentproduct engineeringapiwindows servicesengineering servicesnetfinancial servicesrelational databaseswcfdigital transfAsp.net MVC Ajax jQuery C# Java script LINQ Entity framework Oops JSON Data Cache SQL Server Application Technologies ,...
sql servernetjqueryjavascripthtmlsqljavaPLSQLXMLSQL Server Integration ServicesLoadSQL TuningaspnetTransactSQLExtractTransfSQL Server Repting ServicesNET FramewUnified Modeling LanguagSr. Developer VB. NET: Candidate should have atleast 2 experience desktop based applications. Should have good knowledge in OOAD and UML. Should be able to write stored procedures in SQL Server....
sqlisodssooadbranddesignrightsdesktopsoftwaretrademarksDatabase TriggersUser Defined FunctionsLog ShippingUDFMaterialized Viewsed proceduresCursData Transfmation ServicesMirringOnline TraSAP ABAP (mid level) SAP ABAP (mid level) About the company Vital Wires is an SAP Consulting and Enterprise Digital Transformation company working with Global Enterprises and Growing SMEs customers in...
sap abapmodule poolhr functionssap consultingsolution designtechno functionalsolution deliverypresentation skillssapaleabapoopsvisitdesignbusinessdigital transfmationSAP FICO LEAD SAP FICO LEAD About the company Vital Wires is an SAP Consulting and Enterprise Digital Transformation company working with Global Enterprises and Growing SMEs customers in India, UAE an...
sap ficosap consultingsolution designpresentation skillssaphisficovisitdesignbusinessmanagementconsultingleadershipenterprisedesignationpresentationimplementationdigital transfmationtransfmationSALES About the company Vital Wires is an SAP Consulting and Enterprise Digital Transformation company working with Global Enterprises and Growing SMEs customers in India, UAE and the US. As a company...
it servicesinside salessap consultinglead generationbusiness operationsbusiness developmentcommunication skillsconsultative sellingsaperprfpssalesvisitenglishsellingbusinessdigital transfmationSAP ABAP WORKFLOW SAP ABAP WORKFLOW About the company Vital Wires is an SAP Consulting and Enterprise Digital Transformation company working with Global Enterprises and Growing SMEs customers in India...
sap abapsap consultingsolution designsolution deliverypresentation skillssaphisaleabapvisitdesignbusinessdraftingmanagementconsultingleadershipenterprisedesignationpresentationdigital transfmationElectrical Engineer Electrical Engineer with 3+ years of experience in design of large substations and internal electrification systems. Required B.,...
merscommissioningsafetytroubleshootinglightingdesignelectrificationDesign FirmsPattern CuttingDesignCADPattern MakingCreative Pattern CuttingRenderSurface Pattern DesigntransfDesign CollabationCraftsmanshExpert in Analog and Digital Electronics, Knowledge of schematics and layout tools, Hands On in the Laboratory, Proven track record of Product Development from concept to production, an Analytical set...
merscommissioningsafetytroubleshootinglightinghand toolslayout toolstest equipmentquality controlproduct developmentdigital electronicsmechanical drawingstechnical assistanceelectrical engineeringtransfRequire Senior Electrical Engineer , Require Senior Electrical Engineer ,...
commissioningcablingmersplcsafetytransfFresher Electrical Engineer Kolkata 10000 - 15000 , Fresher Electrical Engineer Kolkata 10000 - 15000 ,...
merscommissioningsafetytroubleshootinglightingtransfMinimum requirements: - Candidates for this position must have a sound knowledge of site activities / commissioning of PLC/ SCADA projects. He should be self- motivated, desire to produce the results ...
salesmarketingnegotiationbusiness developmentcustomer relationselectrical engineeringplcscadasoundengineeringelectronicscommissioninginstrumentationPower SystemsSwitchgearPower DistributionmerTransfSubstaMinimum requirements: - Candidates for this position must have a firing inspiration, an eye for detail, efficient marketing practices, and a self- motivated desire to produce variety of Clients, Proje...
salesmarketingbusiness developmentdeliveryautomationelectrical engineeringplcengineeringelectronicsinspirationinstrumentationPower SystemsSwitchgearPower DistributionmerSubstationRelaysHigh VoltageTransfMinimum requirements: - Candidates for this position must have a firing inspiration, an eye for detail, efficient marketing practices, and a self-motivated desire to produce variety of Clients, Projec...
salesmarketingbusiness developmentdeliveryautomationelectrical engineeringplcengineeringelectronicsinspirationinstrumentationPower SystemsSwitchgearPower DistributionmerSubstationRelaysHigh VoltageTransfLegal Advisor LLB/ BA LLB Fresher/ Practice OFFERED SALARY AS Per Industry Foundation Manpower Management: Manpower Service Provider in Kolkata / Technical / Non- Technical Email id: Recaptcha require...
legaldraftinglitigationlawagreementsbusiness analysismobilemanagementmanpower managementemailrobotsalarybusinessanalysiscopyrightHR TransfmationStrategic Human Resource PlanningDeferred CompensationJob description and job responsibilities: - - .Net Developer We are looking for someone with 2 years of experience as a .Net programmer with all the relevant skills including an expert knowledge of ...
sql servernetjqueryjavascripthtmlclassic aspaspVisual InterdevActiveX Data ObjectsCOMDHTMLVB5ActiveXVBScriptVSSWindows Communication FoundationLanguage Integrated QueryData Transfmation ServicesElectrical Design Engineer HLK INFRASTRUCTURE PVT LTD Candidate must have the capability to design a Project/ Building Electrical details based on drawings and details provided by the Architects or...
autocadlightingearthingmersmershop drawingswiring diagramselectrical designbarboqdrawvisitdesignsalarydiagramseducationinterpretarchitectsconstructiontransftransfking drawingsPRDC/ Careers: Electrical Engineer System Studies | Power Research & Development Consultants Pvt. Ltd Electrical Engineer System Studies Job Information To handle Power System consultancy assignment...
merscommissioningsafetytroubleshootinglightingpower systemsystem studydata collectioncustomer interactionltdsoftwareresearchplanninganalysislogisticsconsultingsimulationcompletioncollectionstransfconsul12 - 15 years of experience in process / light engineering industry. Exposure in the field of HV / MV / LV switchgear & transformer, AC / DC Motors / drives & PLCs, Instrumentation, P&I, Cabling & Pip...
project engineering managementhazardous areaspiping engineeringhvacplcsdrivesplantscablingrunningconverterswitchgearengineeringmerinstrumentationFront End Engineering DesignEPCdc mottransfDesign - B.Tech / B.E. / Diploma in Electrical Engg. Min. 7 to 10 years of experience in Transformer Industry.,...
designmerDesign FirmsPattern CuttingDesignCADPattern MakingCreative Pattern CuttingRenderSurface Pattern DesignCraftsmanshipRelaysProtective RelaysSwitchgeartransfDesign Collabationt CircuitSubstaJob Title : SQL Server Guru Department: Development Location: Mumbai, India Description: This position requires a thorough knowledge of Oracle 8i, Microsoft SQL Server 7.0, professional DBA exp...
microsoft sql serversql serverproject administrationmicrosoft sqlsqlolapdesignschemadatabasefeaturesconsultinginstallationdata transfmation servicesacle 8icustomer suppdata transfmationaclePHP/ MYSQL/ JQuery specialist possessing 2 years of technical experience in IT Industry while actively involved in Analysis, Database Design, Coding. Excellent programming skills in CakePHP Framewor...
mysqlphpjqueryjavascripthtmldatabase designajaxhtml5designcakephpanalysisdatabaseSQL TuningOnline Transaction ProcessingDatabase Developmented ProceduresData Transfmation ServicesData ArchiteDuties and Responsibilities, Insert customer and account data by inputting text based and numerical information from source documents within the time limits., Verify the accuracy and the credibili...
htmlqualityschedulingresearchadvertisingdatabasenumericalSQL TuningRMANOracle RACData GuardDatabase DesignLoadSQL Server Integration ServicesPerfmance TuningTransactSQLExtractTransfScientifi© 2020 Skillindia All Rights Reserved