Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Experience: 10- 12 years
A senior/lead front-end web developer is responsible for implementing visual elements that users see and interact with in a web application.
They are suppo...
salesbusiness developmentconsultingcustomer relationsdeliverysoftware development life cycleaxure rpfront endlife cycleweb servicesunit testinguser experiencecoding standardsagile methodologydefect managementproject managementproduct develSummary of Job
A revolution is brewing, and Absolutdata is the epicentre of the revolution called Big Data - A megatrend impacting every facet of business decision making....
salesmanagementmiscustomer relationsqualitysoftware development life cyclebig dataaxure rpfront endlife cycleweb servicesunit testinguser experiencemachine learningcoding standardsagile methodologydefect managementunstructured dataprojecThe Informatica User Experience (UX) team propels the design and usability of a broad spectrum of data-integration and data-management products. We are a globally diverse, world-class group of designe...
advertisinginsurancenationalportalsstudiobig datauser flowsdata qualitydata securityuser researchdesign briefsgraphic designdata managementFront End Developer/ Designer Coding Skills Solid working knowledge in native Javascript and JS libraries such as JQuery/ UI, Dojo, Prototype, Kendo UI and CoffeeScript. Expert level knowledge in ...
jqueryzendhtmlbootstrapseojavascriptsassdojojsonphpcssconceptual designprint designemail marketingkendo uifront endgraphic designhtml 5Responsibilities: Design beautiful web art mockups (Desktop and Mobile) Coordinate projects independently and work directly with clients Design supplementary marketing materials (email templates...
documentationlogisticsshippingchasalesbranding identity marketingadobe photoshopuser experiencecommunication skillsstatements of work sowwritten communicatiomarketing materialstime managementsocial media* Duties and Responsibilities - WHY THIS POSITION IS REQUIRED Our footprint is growing manifolds and the points of interaction with the customer are multiplying. We need to ensure that we create highl...
bankingfinancefilingmissimplifying the complexvisual designdigital assetsinteraction designquality orientationperformance metricssoftware developmentagileaxuredesignmobilebalancemetricsadobeUI Designer EXPERIENCE REQUIRED: 2+ YEARS REQUIREMENTS: Two or more years of experience in HTML5, CSS3 and Bootstrap. Develop UI mockups and prototypes that clearly illustrate how sites function a...
css3adobe photoshophtmljquerycssfront endproblem solvinghtml5basicdesignmobilebannersoutlookmockupsphotoshopportfoliojavascriptdreamweaverWeb StandardsAbout KOKO Networks KOKO Networks is a venture-backed technology company currently operating in Kenya and India. Our mission is to imagine and deliver technology that transforms life in the world s f...
designmass marketadobe photoshopautocadproduct designcost savingstake orderscontinuous improvement facilitationuser researchvisual designconsumer goodHi, Please find Job Description below, Exp - 2-4 Years. Location : Bangalore Role name: UI / UX designer. - As...
user flowsdesign briefscreative directionbasicsketch appproject administrationmapslanding pagessite mapsdesign guidelinesdesignuser experiencedesign thinkinguser journeysadobe suiteemailnicegraspadobeAbout the role You will be a part of a tight-knit team of innovative folks, and as a UX designer you would be leading on all aspects of User Experience for product development projects across the org...
domain namesmail sortingcustomer relationsuse casesuser experienceonline servicescard sortinginteraction designresearchdesignquick turnaroundproduct developmentproduct portfoliomarket researchhpuxFront End Developer/ Designer Coding Skills Solid working knowledge in native Javascript and JS libraries such as JQuery/ UI, Dojo, Prototype, Kendo UI and CoffeeScript. Expert level knowledge in ...
jqueryzendhtmlbootstrapseojavascriptsassdojojsonphpcssconceptual designprint designemail marketingkendo uifront endgraphic designhtml 5Risevertise Media is a design studio that enables brands to communicate stories and create exceptional user experiences. Through strategic insights and tailored design solutions, we collaborate with p...
usabilitycss3wireframesaxureprototypehtml 5user experiencejava scriptbalsamiq
Take your next career step at ABB with a global team that is energizing the transformation of society and industry to achieve a more productive, sustainable future. At ABB, we have the clear ...
javacustomer relationslinuxautomationcorel drawuser flowsjquery mobileadobe photoshopsolution designcomputer scienceadobe illustratorproduct managementRoles and Responsibilities Educational Details:- Diploma/ graduation related to painting, multimedia Candidates from other streams with relevant work experience can also app...
html5data visualizationuser profilingvisual languagedesign supportpvcmobileportalcsscss3adobe photoshopwebsite managementaxuremanualvisual designdesigninformation mappingjqueryhtmlUI Developer - Job Description JPMorgan Chase is a leading global financial services firm with assets of $1.1 trillion and operations in more than 50 countries. The firm is a leader in investment ban...
web servicesxmltechnology architecturereference datadocument managementwealth managementsupport managementjqueryjavascriptcsshtml 5transaction processinghtml
Skills
About MoEngage MoEngage is a young, fast-paced workplace that fosters a culture of innovation, ownership, freedom, and fun while building tech products of the future...
marketingsalesproduct developmentproduct managementbias for actionsoftware product managementbig datauser researchcustomer datadata trackingproduct designdata management Roles and Responsibilities:
1.Understand product specifications and user psychology.
2.Conduct concept and usability testing and gather feedback.
3.Create personas thr...
Looking for a dynamic professional with sound experience as a leader in areas of Design, Content, UI/ UX, Digital Marketing Advertising, and Team Account Management. Have exposure working in Agile and...
adobe creative suitemobile application designaxure rpteam buildingadobe acrobatsocial designmarket researchteam managementemerging trendsmicrosoft officesecondary marketcard stingmail stingdigi
This is a full time position (not a contract position) for an experienced Senior UI Developer . During this engagement you will work with clients and relevant...
jquerycssjavascripthtmlhtml 5adobe creative suiteon sitefront endcolor theorygrid systemsvisual designgraphic designuser experiencedesign patternssoftware designtime managementcomputer scienceweb applicationsstrategic designmobile platfJob Summary: The Product Manager I will own a product feature and lead project execution. He/she will own the development plan and represent their feature within the PM team and will have an internal ...
salesovercome obstaclesequipment supplyprocess improvementdeliveryproduct managementproduct marketingproduct developmentmarketingbusiness strategymusic making
* Role: Designing & Development Team at Xoriant empowers the future with latest technology, working across Service Delivery Life Cycle. As a UX Designer, you will have to:
Front End Developer/ Designer Coding Skills Solid working knowledge in native Javascript and JS libraries such as JQuery/ UI, Dojo, Prototype, Kendo UI and CoffeeScript. Expert level knowledge in ...
jqueryzendhtmlbootstrapseojavascriptsassdojojsonphpcssconceptual designprint designemail marketingkendo uifront endgraphic designhtml 5About Team: We are Digital Engineering Team - the Software Center of Excellence for Thermo Fisher Scientific. We are responsible for developing and delivering SaaS based applications...
web standardsdesign strategyphotoshopdesign patternsinteraction designadobe photoshopuser experiencenavigation systemsadvertisinggraphic designUI/ UX Designer Photojaanic Enjoy free shipping on orders over Rs. 1500. Code: FREESHIP. UI/ UX Designer UI/ UX Designer Help design happiness. Were looking for a photography and storytelling- lovin...
designresearchhpuxios designproduct visionstrong analytical skillsuser experiencequartz composeranalytical skillsproduct developmentenglish languagedesign patternscustomer relationsgraphic designWe are seeking a creative, talented and knowledgeable designer capable of producing stunning, user- centric web/ mobile interfaces. Self- starter, that is, able to collaborate actively with others in ...
customer relationsresearchdesigncolor theorygrid systemsfile transferprimary researchmobile platformsinteraction designbusiness developmentadobe suiteioshtmlflexadobeagileaxurecolorhpuxResearches, ideates, designs, tests, validates and measures solutions to meet client needs and business goals through new and existing applications, using established best practices for software desig...
graphic design softwarevisual designuser researchdigital designgraphic designsoftware designproduct strategyinformation designmobile applicationsinformation systemsinterface designaxureadobePrimary Skills: UX Assessment , Design Thinking Alternate Skills (if applicable) : UX Strategy, Benchmarking, High Level Design, Information Architecture, Web (Enterprise or Consumer) Mobile and Table...
high level designcard sortinglevel designmail sortingvisual designdesign thinkingweb technologiesinformation architecturehtmlaxuredesignmobilestrategyphotoshopassessmentevaluationheuristicswireframingomnigrafflearchitectureDescription Overall Responsibilities:
Description Overall Responsibilities:
Translate concepts into user flows, wireframes, mock-ups and prototypes that lead to intuitive user experiences. Facilitate the client s product vision by researching, conceiving, sketching, prototypi...
customer relationsresearchdesignuser flowsproduct visionkpohtml5basicaxureresumesoftwaredatabaseanalyticssketchingprototypingomnigrafflecss3hpuxSummary of Job
A revolution is brewing, and Absolutdata is the epicentre of the revolution called Big Data - A megatrend impacting every facet of business decision making....
salesmanagementmiscustomer relationsqualitysoftware development life cyclebig dataaxure rpfront endlife cycleweb servicesunit testinguser experiencemachine learningcoding standardsagile methodologydefect managementunstructured dataprojec
Experience: 10- 12 years
A senior/lead front-end web developer is responsible for implementing visual elements that users see and interact with in a web application.
They are suppo...
salesbusiness developmentconsultingcustomer relationsdeliverysoftware development life cycleaxure rpfront endlife cycleweb servicesunit testinguser experiencecoding standardsagile methodologydefect managementproject managementproduct develTranslate concepts into user flows, wireframes, mock-ups and prototypes that lead to intuitive user experiences. Facilitate the client s product vision by researching, conceiving, sketching, prototypi...
customer relationsresearchdesignuser flowsproduct visionkpohtml5basicaxureresumesoftwaredatabaseanalyticssketchingprototypingomnigrafflecss3hpuxDescription ABOUT ZYCUS: Zycus is a leading global provider of A.I. powered Source-to-Pay suite for procurement, finance, and AP organizations. Our comprehensive pro...
project managementresearchproduct portfoliointeraction designdesignspend analysisuser researchsupplier managementcustomer relationsfortune 1000contract managementhpuxWe are seeking an excellent design leader to manage and help designers and researchers on our product team realize and together, become the best design team in the industry. This role includes all th...
user flowscomplianceuser researchproject managementproduct marketingfinancereportingclean designcustomer relationsanalytical skillsproduct portfolioadvisoryproduct managementcustomer researchspend analysisproduct designDescription Zycus is seeking an excellent design leader to manage and help designers and researchers on our product team realize and together, become the best design team in the indus...
business requirementsusability testinganimationuser researchvisual identity designflashuser flowsmarketinguser journeysvisual designuser experienceclean designuser storiesgraphic designDescription ABOUT ZYCUS: Zycus is a leading global provider of A.I. powered Source-to-Pay suite for procurement, finance, and AP organizations. Our comprehensive pr...
customer researchproduct marketingspend analysisuser researchproduct portfolioproject managementclean designproduct designanalytical skillsuser flowsResponsibilities: - Oversee all design projects, from conception to delivery. Design original pieces, including illustrations and infographics. Review junior designers work to...
customer relationsresearchdesignvisual artsimage editinggraphic designediting softwarebscbrandfontseditingsoftwareindesignmarketingphotoshopportfoliotypographyhpuxadobe
Understand product specifications and user psychology
Conduct concept and usability testing and gather feedback
Create personas through user research and data
...
Responsibilities
6+ months of work experience as trainer on BDE/BA in IT to trained fresher.
Candidate should have knowledge of HTML/CSS/CMS/MVC and software development life cycle (S...
software development life cycleroot cause analysisstrong communication skillslife cycleroot causeflow chartsemail marketingdata managementdata validationmarketing campaignssoftware developmentcommunication skillsfunctional specifications
Graduate or Post Graduate in any curricular stream; candidates from mass communication / Journalism / English literature background preferred
English, Education/Learning Design, Media rela...
content managementinstructional designcustomer relationse learningsmesubject matter expertsms officegoogle docsvisual designcontent writingtime managementsocial learningcreative designmicrosoft officeenglish languageneeds assessmentvirtual
Graduate or Post Graduate in any curricular stream; candidates from mass communication / Journalism/English literature background preferred
English, Education/Learning Desig...
content managementinstructional designcustomer relationse learningsmesubject matter expertsms officegoogle docsvisual designcontent writingtime managementsocial learningcreative designmicrosoft officeenglish languageneeds assessmentvirtualAbout Fractal: Founded in 2000, Fractal Analytics (www.fractal.ai) is a strategic analytics partner to the most admired Fortune 500 companies globally and helps them power every human...
interaction designuser flowsheuristic analysisstrategic designartificial intelligencesolution designandroiddesign researchstrategic analyticsnicecitrixuser researchbrainstormingipadsocial mediausercentered designLooking for a dynamic professional with sound experience as a leader in areas of Design, Content, UI/ UX, Digital Marketing Advertising, and Team Account Management. Have exposure working in Agile and...
adobe creative suitemobile application designaxure rpteam buildingadobe acrobatsocial designmarket researchteam managementemerging trendsmicrosoft officesecondary marketcard stingmail stingdigiFront End Developer/ Designer Coding Skills Solid working knowledge in native Javascript and JS libraries such as JQuery/ UI, Dojo, Prototype, Kendo UI and CoffeeScript. Expert level knowledge in ...
jqueryzendhtmlbootstrapseojavascriptsassdojojsonphpcssconceptual designprint designemail marketingkendo uifront endgraphic designhtml 5Accedo is looking for a talented Senior UX/ UI designer with a minimum of 6 years of experience in our New Delhi based office. The candidate must have the necessary UX and UI skills and know the UX pr...
css3adobe photoshophtmljquerycsssmart tvvideo servicesuser experiencevirtual realityservice providersknowledge sharinginteraction designcareer developmentking experienceking environmentcommun© 2020 Skillindia All Rights Reserved