Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Responsibilities : - Be a part of the Product solutions team, which manages and designs the integration ecosystem with 3rd parties at Unicommerce, in the e-commerce integration space. - Collaborate wi...
marketingsalesproduct developmentproduct managementdeliverydata flowlife cycleproblem solvingapi developmentcomputer sciencesequence diagramsOur Client is worlds leading banks and provides its clients with investment banking, private banking and asset management services worldwide. It has a long tradition of meeting the complex financial n...
strong analytical skillsprivate bankingcost allocationglobal servicesasset managementlogical approachanalytical skillsadvisory servicescontrol frameworkinvestment bankingbehavioral trainingmanagement servicesfpaRole description : - Support client digital projects or parts of large projects in manufacturing and aerospace automotive domain - Participate in requirement elicitation sessions with client t...
customer relationsdocumentationrequirementsfunctionalbusiness requirementscontinuous improvement facilitationuse casetest casesthought leadershipsalesmarketing* The role of Business Analyst within Managed Services is responsible for effectively delivering and embedding change and continuous improvement initiatives - triggered either by regulatory or contr...
impact analysisbusiness analysisms visiomanaged servicesmultiple sitescommunication skillscustomer serviceglobal servicesimpact assessmentmicrosoft officebusiness requirementsElectronics & High Technology (Management Consulting) Must : IT experience, Strategy, Business Analysis, Project Management, Agile/Waterfall, Change Management Domain : E...
life cycleflow diagramsclient trainingforeign languagesprocess designglobal salesbusiness analysiscomputer hardwaretier 2change managementoffice equipmentcase analysisproblem solving* Duties and Responsibilities - Responsibilities Business Capability: 1. Project Management for building and supporting the Two wheeler development 2. Industry benchmarking for opportunities for syste...
bankingfinancefilingmisuser storiesmicrosoft officeproject deliveryproject managementbfsiriskbrdssaleschartcredittestingcontrolbusinessmanagementnbfcHiring from TOP FMCG companies only. Female only will be consider. Key responsibilities - Route to market Consulting (Sales, Distribution, B2B, E Commerce, Trade promotion etc) for CPG clients in Indi...
b2bcpgrtmstrategyanalyticsconsultingdistributiontransformationVARTMFilament WindingReSAPultrusionFRDThermosetBRDFRPBRDsCorporate DevelopmentMarket EntryExecutive ManagementDear Candidate, Greetings of the day! We are Hiring forSolution Analyst - BFSI About this Role This role will focus on increasing client adoption ...
business intelligencewebservicesrestsolution analyst - bfsi- Deliver consulting assignments - Work with business consulting assignments independently or part of cross functional teams across regions. - Take up a range of roles within retail and digital bankin...
customer relationssqlsalesstory writingaustralian equitiesbusiness developmentproject developmentproblem solvingprocess consultingbusiness consultingdeliverybusiness analysisproject financesapJD- Associate Product Manager, Solutions (3-5 Years) Responsibilities - Be a part of the solutions architecture team, at Unicommerce, in the e-commerce enterprise integration space. - Collaborate with...
marketingsalesproduct managementdeliveryagiledata flowlife cycleproblem solvingapi developmentcomputer sciencesequence diagramssoftware engineeringResponsibilities : - Be a part of the Product solutions team, which manages and designs the integration ecosystem with 3rd parties at Unicommerce, in the e-commerce integration space. - Collaborate wi...
marketingsalesproduct developmentproduct managementdeliverydata flowlife cycleproblem solvingapi developmentcomputer sciencesequence diagramssoftware engineeringsolution architecture- This role will work closely with business stakeholders, management to ensure deliverables fall within the applicable scope and budget. He or she will coordinate with other departments to ensure all ...
agilecustomer relationsdocumentationdeliveryrequirementsuse casessite visitsrisk managementcomputer sciencebusiness analysisworking experiencestatements of work sowIndustry - Internet / Online / eCommerce Category - Sales & Marketing Skills - Design, Catalogue, Ecommerce Job Type - Permanent - Manage day-to-day Studio Operations that includes Product and mode...
team buildingaopmanagement systemsprogram managementservice levelconflict managementimage editingmarket researchtestsdesignvendor negotiationsbrdsretailvideobrandsales* Duties and Responsibilities - Be the Product Manager and owner of E-Commerce platform focussed in Consumer Durable Financing. Create digital customer journeys by understanding the customer pain poin...
test casesscrum masterproduct strategybusiness analysisproduct managementcompetitor analysisagile methodologiesinformation technologyproject administrationfunctional requirementsagile scrumHiring from TOP FMCG companies only. Female only will be consider. Key responsibilities - Route to market Consulting (Sales, Distribution, B2B, E Commerce, Trade promotion etc) for CPG clients in Indi...
b2bcpgrtmstrategyanalyticsconsultingdistributiontransformationVARTMFilament WindingReSAPultrusionFRDThermosetBRDFRPBRDsCorporate DevelopmentManager - User Acquisition Location Bangalore, India Who we are & What do we do InMobi Group s mission is to power intelligent, ...
cross promotionscampaign analyticscommunication skillsacquisition campaignsapi documentationmarket trendsapiadsroibrdsgameslatamandroidwritingclaritymetricsRole description - Support client digital projects or parts of large projects in manufacturing/automotive domain - Participate in requirement elicitation sessions with client teams - Develop B...
use casetest casesthought leadershippractice developmentproduction engineeringstakeholder managementbrdssalesbranddesignbusinessanalysissourcingmarketinglogisticsmanagementsalesmarketingNMIMS Global Access School for Continuing Education is looking for a Product Manager to help build our homegrown Learning Management System and CRM. In this role, you will work closely with a team of ...
marketingsalesproduct developmentproduct managementdeliverymanagement systemlearning managementcontinuing educationagileaccessstrategyeducationmanagementoperationsanalyticalHiring from TOP FMCG companies only. Female only will be consider. Key responsibilities - Route to market Consulting (Sales, Distribution, B2B, E Commerce, Trade promotion etc) for CPG clients in Indi...
b2bcpgrtmstrategyanalyticsconsultingdistributiontransformationVARTMFilament WindingReSAPultrusionFRDThermosetBRDFRPBRDsCorporate DevelopmentMarket EntryExecutive Management* Duties and Responsibilities - Responsibilities App and Web Partner Project Management: 1. Project manager for building and supporting the Partner App & Web development 2. Understanding of business d...
bankingfinancefilingmisagile project managementit marketinguser storiesvisual designuser journeysweb developmentproject deliverybusiness processnbfc* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about much mor...
functionalbusiness requirementsrisk metricsliquidity riskfinancial riskbusiness analysischange managementfinancial marketsdata visualizationregulatory reportingregulatory guidelinesstakeholder managementKey Responsibilities 1. a. Payments (Electronics & Manuals): Transaction monitoring and processing. Serve as either maker , checker or authorizer of the transactions received. Ensure that transaction...
accountsproduct verificationcomplianceroot causeswift messagingpreventive actionscustomer relationsreportingissue resolutionbankingstatements of work sowJPMorgan Chase & Co. (NYSE: JPM) is a leading global financial services firm with assets of $2.6 trillion and operations worldwide. The firm is a leader in investment banking, financial services for c...
functionalbusiness requirementstransaction processingbusiness analysisinvestment bankingtechnology trendsbusiness operationsglobal financefinancial servicesrisk managementrisk analyticscommercial bankingDear Candidate. Pls find the Job Description. Understanding Business Needs Understand the intensity of change, affected groups and plan to address the concern for each group. Enco...
six sigma black beltquality toolsbusinessanalyst* Duties and Responsibilities - Business Capability: 1. Project Management for key system developments to support B2B business 2. Process Mapping to find areas of opportunities for system enhancements...
bankingfinancefilingmisuser storiesprocess mappingmicrosoft officeproject deliveryproject managementnbfc* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about much mor...
project managementjavadeliveryreportingcustomer relationsglobal policyrisk managementregulatory riskmicrosoft officebusiness processquality standardsmanagement skillscorporate liaisonstatements of work sowCore Responsibilities:
We are hiring for Business Analyst for leading IT company Top IT Banking company Description Experience - 5 -10 Years Location - Chennai - Writing and Reviewing BRDs, FSDs, User Stories and working c...
customer relationsdocumentationrequirementsfunctionalbusiness requirementsuser storiesrisk managementforeign exchangebusiness analysisDeputy Manager Business Excellence & Operations Six Sigma Black Belt Roles and Responsibilities MT-Business Excellence Should Hav...
customer experiencesix sigma black beltblack belttraining programslean six sigmabusiness processquality standardsvalue stream mappingsix sigmateam managementcontinuous improvement facilitationclient servicingmusic makingquality circlecost reImp: Immediate to 1 Month joiner only. - Strong aptitude with Data Analysis and Interpretation skills - The ability to critically evaluate information gathered across multiple sources, using multiple...
business requirementsrequirementsuat coordinationvariety of audiencescustomer relationsproblem solvingdocumentationdata analysisfunctional
* Duties and Responsibilities - Business Capability: 1. Project Management for building and supporting new capabilities in RGL Business 2. Write BRDs and User stories along with requisite KPIs for the...
bankingfinancefilingmisbusiness process improvementuser storiesteam operationsmicrosoft officeproject deliverybusiness processresolving issuesproject managementprocess improvementbfsibrdssalesnbfcThe Business Systems Analyst is responsible for business requirements gathering, requirements clarification and documentation of requirements. Works independently regarding complex functionality to su...
environmental impact assessmentuse casesuser storiesrisk assessmentbusiness systemsbusiness analysiscorporate liaisonagile environmentstatements of work sowPosition Type : Full time Type Of Hire : Experienced (relevant combo of work and education) Education Desired : Bachelors Degree Travel Percentage : 0% S...
javasqljavascriptsql serverjquerywriting test casesremote infrastructure managementtest casestest scriptstest analysistest executiononline privacyPROCESS:
* Duties and Responsibilities - Business Capability: 1. Project Management for key system developments to support Personal loan business 2. Process Mapping to find areas of opportunities for system en...
microsoft officeinsurancecontrolbasicbusiness developmentmanagementsourcingmarketingtestingchartprocess mappingsalesbusinessproject managementpowerpointuser storiesLead Growth Marketing Location Bangalore, India Who we are & What do we do InMobi Group s mission is to power intelligent, mobile-first experienc...
data analysissecondary researchapi documentationmarket trendsseoapiroibrdsgameslatamreachmobilewritingclaritymetricsshapingmarketing campaignsmarketing automationcadence* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about much mor...
customer relationsdocumentationbusiness requirementstest casesrisk metricsliquidity riskfinancial riskbusiness analysisfinancial marketsdata visualizationsystem architectureregulatory reportingregulatory guidelinesAbout EY As a global leader in assurance, tax, transaction and advisory services, we re using the finance products, expertise and systems we ve developed to build a better working world. That starts ...
salesmisaccountstatbankingus gaapmusic makingdata analyticsexternal auditliquidity riskfinancial dataeconomic growthpublic interestautomation toolsadvisory servicesfinancial servicesfinancial reportingRoles and Responsibilities Hi, Warm Greetings from GSN!! Pleasure connecting with you!! We been into Corporate Search Services for Identifying & Bringing in Stellar Talented Profes...
change requestschange impact analysisbehavioral trainingcabsearchrequest trackerchange control boardclient coordinationapplication developmentcssssejqueryimplementationuser requirementsfrdctcchange readinessbrdsnonfunctional requiremeMarkets Business Reporting & Analytics: Associate Description About J.P. Morgan Corporate & Investment Bank J.P. Morgan s Corporate & Investment Bank is a global l...
deliveryproject managementcustomer relationsreportingjavasoftware development life cycletrade life cyclems officelife cycledata miningfront officedata qualitymis reportingdata analysismiddle office*ABOUT US Morgan Stanley is a leading global financial services firm providing a wide range of investment banking, securities, investment management and wealth management services. The Firms employees...
analyticsbusiness intelligencereportingsalesaccountingreference datait developmentprime brokeragecapital marketsbusiness analysiswealth managementpeople managementclient onboarding* About BNP Paribas Group: BNP Paribas is a top-ranking bank in Europe with an international profile. It operates in 71 countries and has almost 199 000 employees. The Group ranks highly in its thre...
retail bankingagiletest casescash managementrequirementsit securitycustomer relationsdeliverycore bankingdocumentationendtoend project managementConsultant, SAP -SD
Business AnalystEXP: 0-0.5 Yrs
About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
sqlunixlinuxsql servertroubleshootingsnag ituse casesbusiness processuser requirementssoftware engineeringprofessional servicesfunctional requirements*Lead a team that acts as the central resource and driving force for the design, process, manufacturing, test, quality and marketing of product(s) as they move from conception to distribution. Organiz...
marketingsalesproduct developmentproduct managementb2b salesuse casesdata mappinguser storiesdata managementuser experienceproduct strategyenterprise softwaresoftware engineeringbusiness requirementsAs a global leader in assurance, tax, transaction and advisory services, we hire and develop the most passionate people in their field to help build a better working world. This starts with a culture ...
salesmisaccountstatbankingus gaapmusic makingdata analyticsexternal auditliquidity riskfinancial dataeconomic growthpublic interestautomation toolsAt least 2 years of experience as Business Analyst. Responding to RFPs (Request for Proposal) for the new business opportunities. Co- ordinate with Technical Team to discuss client requirements and th...
customer relationsdocumentationrequirementsfunctionalbusiness requirementsnew businessclient requirementsrequirements analysisrequirements managementrfpssalesdesignwritingbusinessanalysisking modelpropAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
operational riskbusiness analysisbusiness strategyleadership skillscommunication skillsprofessional serviceswritten communicationbusiness requirementsproject implementationtechnology integrationbrdrisksnowbrdscloud© 2020 Skillindia All Rights Reserved