Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about much mor...
community of practicesource system analysisrisk management frameworkenterprise risk managementenvironmental impact assessmentsap bwbig datapower bicore datadata sciencedata qualityAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
javajavascriptsqlcustomer relationshtmllevel designteam handlingreporting toolproject reportsbusiness processanalytical skillsperformance tuningreport developmentsoftware engineering
ROLE SUMMARY At Pfizer, we make medicines and vaccines that change patients lives with a global reach of over 780 million patients. Pfizer Digital is the organization charged with winning the ...
equal employment opportunitybusiness intelligence reportingdata modelscore financetime managementcomputer sciencework instructionsmatrix leadershipdata visualizationperformance tuningmobile integrationResponsibilities : - Act as single point of contact into the DA Team for support and analytical integration into the audits - Work to define and solution data sourcing capabilities and needs for the a...
sqldata analysismicrosoft excelcustomer relationsreportingetl toolsdata analyticsdata reportingproblem solvingdata governancecomputer sciencedata integrationdecision supportResponsibilities:
Roles and Responsibilities : Technical Skills, Requirements : - Proven experience as a Power BI on Development side - Good knowledge of Python - Having clear understanding of Media Analytics KPI, Data...
data modelssql server integration servicessalesinsuranceunit testingvisual studiocustomer relationsmisqualitysql server reporting servicessql queriesdata analysispower bisql serversql server reporting services ssrsDART (Data, Analytics and Reporting Team) is poised to be the central MIS group for all functions in the CCB Operations. We are a global group with presence in US, India & Philippines. The po...
customer relationsdocumentationrequirementsfunctionalbusiness requirementscall center technologydata analysiscommunity bankingcall centerWe are currently Looking for Python Developers for one of our major client, Nice Software Solutions - www. nicesoftwaresolutions. com/ About Nice Software Solutions : It is one of the top business i...
pythonmysqldjangohtmlcssReq ID:162665 NTT DATA Services strives to hire exceptional, innovative and passionate individuals who want to grow with us. If you want to be part of an inclusive, adaptable, and forward-thi...
agile plmms sqlrevenue cycledata analysisagiletime managementwebsphereit servicesmultiple projects simultaneouslydata servicesjavapower biaspnet 35Heres what we are looking for : - Experience level of 2 to 6 years of experience in JAVA and its related frameworks, Javascript, Springboot, Spring MVC. - Strong problem-solving skills, computer scien...
javamysqljsphibernatespringpower bifront endreporting tooldata structuresproblem solvingcomputer sciencecoding standardsworking experiencexmlcssapisdklinuxdesigntableau* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good pe...
data qualitydata analysisquality checkdata integrityreporting toolquality controlrisk assessmentsolution designproject deliveryquality assuranceinformation systemsinformation securityportfolio management
Possess good knowledge on different suits of Micro Strategy and the Performance tuning methods. Experience in databases like Oracle, Teradata & SQL Server. Experience in cr...
microstrategydeveloper
Hiring for MicroStrategy Developer. MicroStrategy Developer Gurgaon,Hyderabad/Secunderabad 7.0 Year(s) - 10.0 Year(s) Apply, Hiring for MicroStrategy D...
microstrategysqlfilterscubessalesMicroStrategy ReportingMobile BINetezzaData MartsROLAPPowerCenterStar SchemaSnowflakeDimensional ModelingDo you know what it takes to deliver change successfully Are you a problem solver Do you have a passion for Data and Analytics Were looking for someone like this to: - analyze business requirement...
big datasql queriesdata modelingproblem solvingcomputer sciencedata warehousingdevelopment workagile methodologyagile environmentdigital conversionstatements of work sowWe are seeking a Sr. MicroStrategy Developer to be part of a team that provides reporting for risk and compliance across all levels of the organization. This position will use their strong understandi...
microstrategysqlfilterscubessalesms sql serverms sqlsql serverunit testingdata securitysolution designenterprise riskdata architecturecommercial modelsphysical modelingprocess improvementsoftware engineeringbusiness intelligenceproject aJob Description Data analysis/data quality/data governance Understand the data model, developed by DW team and prepare a logical data model Should have expertise in MicroStrategy 2019.x, Tableau Serve...
microstrategyfilterssalessqlcubesWe are looking for a hands-on, Big Data Developer to join our Analytics team . We re looking for this developer to: build and maintain Big Data solution for Finance data and reporting/analytics full...
hadoophivejavasqooppythonbig datafile systemscrum masterfinancial dataproblem solvingdata warehousingagile methodologyknowledge discoveryEngineering Manager As a part of this role he/she will be responsible for designing and developing core product architectural and functional components for Roche enterprise SaaS business an...
quality systemsecure codingbusiness analyticstechnical designdata warehousingtotal cost of ownershipbig databusiness intelligence toolsdata modelingbusiness objectsjasper reportscommercial modelsWork with internal teams and client stakeholders to understand business goals, existing BI reports, KPIs, raw data sources and clarify visualization requirements / goals Identify key business metrics ...
issue resolutiondata visualizationtechnical architecturedesignchartsgraphsthemestableaumetricsclarifytrainingqlikviewsoftwarebusinessanalyticsdashboardWe are looking for MicroStrategy Developer with 3-5 years of experience in Software Product development with following core attributes
Description: DART (Data, Analytics and Reporting Team) is poised to be the central MIS group for all functions in the CCB Operations. We are a global group with presence in US, India...
customer relationsdocumentationrequirementsfunctionalbusiness requirementscall center technologydata analysiscommunity bankingbusiness operationsbusiness intelligencemissassqlcall centerWe are currently Looking for Python Developers for one of our major client, Nice Software Solutions - www. nicesoftwaresolutions. com/ About Nice Software Solutions : It is one of the top business i...
pythonmysqldjangohtmlcss* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about much mor...
road mapsdata qualitydata leakagemusic makingdata analysisproject managerspeople managementaccess managementsecurity servicesfinancial servicesposition managementHeres what we are looking for : - Experience level of 2 to 6 years of experience in JAVA and its related frameworks, Javascript, Springboot, Spring MVC. - Strong problem-solving skills, computer scien...
javamysqljsphibernatespringpower bifront endreporting tooldata structuresproblem solvingcomputer sciencecoding standardsworking experiencexmlcssapisdklinuxdesigntableauResponsibilities : - Act as single point of contact into the DA Team for support and analytical integration into the audits - Work to define and solution data sourcing capabilities and needs for the a...
sqldata analysismicrosoft excelcustomer relationsreportingetl toolsdata analyticsdata reportingproblem solvingdata governancecomputer sciencedata integrationdecision supportAre you an analytic thinker Do you know how to develop innovative solutions We re looking for someone like that who can: turn data into an asset across the organization using visualization and othe...
power bidata sciencebusiness unitsenterprise datamachine learningfinancial servicesthought leadershiptechnology solutionsbusiness intelligencefinancial justificationrasdrawturnsparkoraclepythonubsRole 1: RPA Developer
We are working to be the most customer-centric company on earth. To get there, we need exceptionally talented, bright, and driven people. If you d like to help the Disability Leave Services (DLS) team...
tactical planningbusiness analyticsforecastingstatistical toolspower bicustomer support operationsprioritize workloadmisleave of absenceschedulingworkforce managementcritical thinkingcapacity planningwfmavayaWe are hiring Manager - Analytics for our client based at Bangalore. - Accountable for engaging with markets to understand their key outcomes, identifying and executing analytics projects that...
music makingpeople managementadvanced analyticsproblem solvingreturn on investmentdecision treesvalue realizationmachine learningretail domain* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about much mor...
user acceptance testingbig datatest casesdata qualityhyperion essbasebanking productshyperion planningimpact assessmentacceptance testingmanagement reportingstakeholder managementetlhfmuatcrs* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about much mor...
etl toolcyber securitylinear algebradata managementsecurity servicestechno functionalbusiness knowledgedata transformationsqletltdrriskturnlakeagilebrandtrustfast trackThis is a Data Warehousing Consultant position which is a key role in Analytics Support. Candidate will be an Individual contributor and key performer within the team and looking forward to s...
sapcustomer relationsdeliverysalessqlunix shell scriptingsource system analysisdatabase management systemcontinuous improvement facilitationcontrol m© 2020 Skillindia All Rights Reserved