Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Skill Requirement :
Objective C , Swift , Xcode , IOS sdk , Cocoa Touch , JSON , JavaScript , SQLite
Strong Object Oriented Programming Skills
Experience with iOS Dev...
Senior Technology Lead (BANGALORE) SENIOR TECHNOLOGY LEAD (BANGALORE) Send in your applications to : hemalatha@gravityilabs.com and smitha@gravityilabs.com Gravity is a Global Australian Innovation c...
solution designjavams sqlservice linescustomer relationsmachine learningactive directorysql serverpersonal skillssoftware design patternsbusiness designinterpersonal skillsreportingstrategy executionasp netsoftware designmanagement systemsFull stack .NET / Angular Developers (BANGALORE) TELERIK REPORT DEVELOPER (BANGALORE) UX DESIGNER (BANGALORE) At Gravity, we create exciting digital experiences for varied corporate clients. We are lo...
mobile devicescommunication skillsinteraction designproject administrationIf you are passionate about sustainability and supporting the energy transition with digital technologies, come and join our team With plans to substantially accelerate our already aggressive technolo...
javaenvironmentsql serversqlcustomer relationsgoogle mapspeer reviewsclimate changecarbon neutralmicrosoft azuregrowth strategytechnical skillsOpening : Software Developer (iOS) No of Position : 2 Nos. Experience : 2-4 Yrs. Qualification : MCA/BE.IT/BE.CE Work Location : Chennai Skill Requirement : Objective C, Xcode, IOS sdk, Co...
sql serverjavascriptjqueryhtmlsqlobject oriented programmingios sdkcore dataapp storeobjective ccocoa touchsocial mediaweb servicesdesign patternsiosxmlsdkOpening : Software Developer (Android) No of Position : 2 Experience : 2-4 Yrs. Qualification : MCA/BE.IT/BE.CE Work Location : Chennai Skill Requirement : Excellent technical knowledge of...
sql serverjavascriptjqueryhtmlsqlgoogle maps apigoogle mapsandroid studioapijavachatmapscodestestingandroideclipsetelerikcommandjuniorsSoftware Engineers (.Net) : 6 months - 4 years Skills : ASP.net, C#.Net, VB.Net, MVC, SQL Server, Crystal reports HTML, DHTML, CSS, Javascript, JQuery, Ajax Web Reporting, 3rd Party Cont ro ls (e....
javasqljavascriptsql serverjquerydesign developmentsoftware engineersprofessional ethicscommunication skillscsshtmlajaxdhtmldesignvbnetethicsweb reptingcrystal repcnetaspnet1.Proficient in custom programming (C#, ASP.NET), .NET development frameworks and ability to develop robust solutions for assigned applications/projects 2.Understands the functional requirements and ...
microsoft azureunit testingsql developmenttest driven developmentweb applicationuser defined functionstest automationms sqlglobal deliveryOpportunities that we offer: Work on the latest Microsoft technologies. Grow with us - professionally and personally. Explore ground transportation & travel domain, and work with the renowned trave...
reporting toolsanalytical skillsstored procedurescommunication skillsprogramming conceptsground transportationobjectoriented programming
Job Description
The core ecommerce platform is based on the MS web stack. Technologies used in the platform include: SQL Server, Entity Framework, MongoDB, ASP.NET, ASP.NET MVC, jQuery, Telerik KendoUI, JSO...
entity frameworkmongodbsql server reporting servicescloudxmlsql servertelerikgitlabjqueryforensicjsonxsltsqlaspnettransactsqlaspnet mvc7+ years of industry experience in developing web-based applications using ASP.NET/C# At least 2 years of experience in implementing websites using Sitecore CMS Experience in .net Framework 3.5 and ab...
sitecoreasp.netDesignation: Software Engineer Roles and Responsibility
Skill Requirement :
Objective C , Swift , Xcode , IOS sdk , Cocoa Touch , JSON , JavaScript , SQLite
Strong Object Oriented Programming Skills
Experience with iOS Development...
Lead Software Engineer I: Software Developer Job Location Bangalore, India OpCo Overview : SCIEX An operating company within Danaher s Life Sciences platform SCIEX helps to ...
open sourcecenter of excellencefortune 500drug discoveryproblem solvingdanaher business systemjquerylife sciencesdata analyticsjavacustomer relationspeer reviewsbuild toolsvisual studiounit testingmvcsql servernet frameworkresearch develOpening : Software Developer (iOS) No of Position : 2 Nos. Experience : 2-4 Yrs. Qualification : MCA/BE.IT/BE.CE Work Location : Chennai Skill Requirement : Objective C, Xcode, IOS sdk, Co...
sql serverjavascriptjqueryhtmlsqlobject oriented programmingios sdkcore dataapp storeobjective ccocoa touchsocial mediaweb servicesdesign patternsiosxmlsdkOpening : Software Developer (Android) No of Position : 2 Experience : 2-4 Yrs. Qualification : MCA/BE.IT/BE.CE Work Location : Chennai Skill Requirement : Excellent technical knowledge of...
sql serverjavascriptjqueryhtmlsqlgoogle maps apigoogle mapsandroid studioapijavachatmapscodestestingandroideclipsetelerikcommandjuniorsMore than 3 years experience as Software Developer in ASP. NET technology in c# Logical and problem solver by his/ her own Concept of Object Oriented Programming Strong knowledge and working experi...
solverkendonetsoftwarehtml5scrumajaxjqueryteleriksqljavascriptentity frameworksql server 2008working experiencetransactsqlmicrosoft sql serversql server reporting servicessql servermicrosoft sqlBE (Computers / IT), MCA, M.Sc. or any equivalent degree Basic Knowledge of ASP.NET MVC framework and MVC Architecture Experience of working with Entity framework, LINQ, JQuery Experience of worki...
javasqljavascriptsql serverjquerytest driven developmenttest casesunit testingagile methodologydevelopment toolssoftwarestatements of wk sowaspnet mvcmvc framewcustomdersentity framewA Top Business house ($55 Bn globally) having interests in Renewable, Chemicals, Textiles, Non ferrous metals, Financial Services & Telecom is hiring for a Lead HR Analyst Location - Mumbai Reporting ...
analyticssqldata collectiondata miningdeliverydata warehousingmachine learningproject managementfinancial servicesbehavioral trainingsuccession planningagilehousemetalsrewardsPosition SOFTWARE ENGG (Tech Lead/Team Manager) Number of post 1 Office Location Tamil Nadu , Coimbatore Annual CTC / Salary As per industry up to 20 L p.a Previous Work Experience 10 Years ...
object oriented programmingweb servicesuser controlscrystal reportscustom controlsentity frameworkDot net Developer Experience: 3 to 5 years of experience on live projects in . Net with SQL Server in the backend . Location: Mohali Location:Mohali Key Responsibilities Proficient in using ASP. ...
sql servernetjqueryjavascripthtmlms sqlsqlnetcssraddotbackendteleriksecuritybusinessdatabaseversioningperformancescalabilityRole: Sr Engr / Tech Lead - Web Backend (ASP.Net) Location BLR or GGN Experience 5 - 10 yrs Domain Digital Applications NP JD - Strong Web backend knowledge in ...
safetycommissioningsiteinspectiontroubleshootingms sqlkendo uientity frameworktelerik controlsanalytical skillssqlapinetkendobackendtelerikanalyticalaspnet web apiaspnet1 .Net Developer WPF (desktop based) (experience required: 3+ years) (C#.NET, WPF) (2 openings) Wpf technology would be an added advantage. We can consider someone who is technically strong in C#.net ...
reporting toolsanalytical skillsstored proceduresprogramming conceptsground transportationwpfwcfnetlinqmvvmtsqldesigntestingwindowstelerikrunningobjectoriented programmingJob Opening Details back to list Reference Code: AR1229 Job Title: Mobile Backend Developer (C#, .Net Dev) Category: skillset - .Net and WCF, MVC, API s IIS configurations Mobile Bac...
mysqljavascriptcssapihtmlobject oriented programmingwindows server administrationenvironmental impact assessmentsql servertest casestortoise svnwindows serversoftware projectA Top Business house ($55 Bn globally) having interests in Renewable, Chemicals, Textiles, Non ferrous metals, Financial Services & Telecom is hiring for a Lead HR Analyst Location - Mumbai Reporting ...
analyticssqldata collectiondata miningdeliverydata warehousingmachine learningproject managementfinancial servicesbehavioral trainingsuccession planningSkills
Job Qualification
© 2020 Skillindia All Rights Reserved