Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
We are looking for a Senior NiFi Data Engineer(Early Joiners ONLY) who is able to design and build solutions for one of our Fortune 500 Client programs, which aims towards building a data stand...
problem solvingjavadata flowdata standardsunstructured datafortune 500agile developmentpythondata modelingdata processingdata warehousinginformaticasqlregression testingdata transformationThe Finance and Risk Warehouse is an organization within JP Morgan s Corporate Technology group responsible for acquiring and integrating data from various product systems within the bank into a singl...
catia v5catiamodelingautomationdefect analysisbig dataetl toolcredit riskdata modelingcyber securityliquidity risktest automationweb technologiesAs a member of our Software Engineering Group, we look first and foremost for people who are passionate around solving business problems through innovation and engineering practices. Youll be required...
environmentweb technologiesliquidity riskdata modelingtest automationetlinformaticacyber securityagile developmentbusiness bankingreportingdata integrationoperating systemscommercial modelsAs a member of our Infrastructure Development team, youll dive right into creating innovative solutions that advance businesses and careers. You ll join an inspiring and curious team of technologists ...
data managementagile developmentcritical thinkingsystems engineeringsoftware developmentprogramming languagesapplication monitoringinfrastructure solutionsinfrastructure developmenttddldap* Job description: Cloudera Admin
Job Opening Details back to list Reference Code: AR1173 Job Title: DevOps Engineer Category: Immediate Joiner Location: Hyderabad 2 to 5 years of experience with implementing funct...
linuxjenkinsgitmavenautomationjava swingapache antweb servicesmusic makingversion controllinux administrationapplication deploymentsqlantredjavabashldapjboss
The Emerging Technology group is a fast paced and exciting product development team which is at the forefront of adopting cloud technology and solving customer problems. We hire talented engin...
javaagileapilinuxroot causetesting toolstest automationsecurity servicesproduct developmentautomation frameworkengineering projectsprogramming languagestechnical consultationauthentication protocolssslperlunix5+ years working in Information Technology 3+ years working in Identity & Access Management 3+ years of experience with attribute and role based access controls Experience of working in a Large Enterp...
active directorycloudpkiazureadJob Opening Details back to list Reference Code: AR1014 Job Title: MongoDB Category: posting ID - 74328 JD: MongoDB (Kaja Muyenudeen) An experienced Database Design and Imple...
mysqlrelational databasesbashoraclemicrosoft azuredb2rhelrbacsecurity implementationemaillinuxamazon web servicesniceazuredatabase designwindows serverldapcommunication skillsweb services
Description As a Scanner QA Engineer you will be part of a highly motivated engineering team that is responsible for ensuring the continued quality of the leading Vulnerability Scanne...
test casesregression testinginspectionqualityautomationsoftware development life cycledeep packet inspectionms sqllife cyclepacket captureautomation toolsdatabase systems
* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about much m...
core javafront endrole modelmarket riskmarket datacode reviewunit testingrisk analysiscloud storagerisk managementshell scriptingspring securityagile environmentfunctional testingintegration testingPrimary Responsibilities
Hi, Gratitude. Hiring for IT firm specialize in Data Center and IT Infrastructure solutions, products, software and services. *Role*-Datacenter en...
cdcpnetwork operationswanccnadatacentre layout designroutersunixlanlinux system administrationdevopsproject managementnetwork connectivitynetwork supportfirmwaretcp/ipproject engineeringsystem administrationfirewall administrationcommuni
Req ID:129659 NTT DATA Services strives to hire exceptional, innovative and passionate individuals who want to grow with us. If you want to be part of an inclusive, adaptable, and f...
server osit servicesdata serviceswindows serveractive directorynetwork securitybusiness processdomain controllerdata synchronizationadministrative assistancepowershell scriptingdnsntpssoPrincipal Software Maintenance Engineer Become part of a fast -paced company that is changing the way software is developed, sold, and supported. The Red Hat Customer Experience and ...
sqlwindowslinuxaccount managementapplication serveropen source softwarejava message servicejava message service jmsjava database connectivity jdbcTitle: SAP Security Consultant Experience: 8 to 12 Years. Client Location: Bangalore
Principal Software Maintenance Engineer Location Remote France Posting date 2 days ago(7/1/2021 9:25 AM) Job ID 88041 Category Software Engineering Job summary ...
sqljava message serviceaccount managementwindowsopen source softwareapplication serverlinuxenterprise javabeans ejbjava database connectivity jdbcjava message service jmsAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
customer relationsdatabase administrationidsmicrosoft accessgroup policyproject supportbuilding securityprofessional servicesdefining requirementspowershell scriptingpkissorptmcseadfsocspcloudReq ID:132222 NTT DATA Services strives to hire exceptional, innovative and passionate individuals who want to grow with us. If you want to be part of an inclusive, adaptable, and f...
autocadcommissioning3d modellingit servicesad migrationdata servicesaccess controlshell scriptingasmeastmidentityaccess managementThe Network Architect will be the subject matter expert for architecting, implementing, testing, and troubleshooting Northern Trust s global network. The position also requires the ability to...
computer information systemsenvironmentframe relayjavaspanning treelayer 2private clouddeliverydata centersalescustomer relations
Essential Qualifications
We re looking for someone like that to: Provide global production support for the Windows distributed infrastructure while on shift. Address incidents picked up by the monitoring systems alerting on...
troubleshootingnetworkingactive directorywindowsdhcpos migrationproblem solvingticketing systemsproduction supportoperational supportTech System AdministratorThe Senior Director - IT will be based in Chennai. We are looking for someone who demonstrates:
* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about much mor...
safetycommissioningsiteinspectiontroubleshootingoracle internet directorysql queriesproblem solvingcomputer scienceanalytical skillsaccess managementstored proceduresfinancial servicesoral communicationReq ID:130187 NTT DATA Services strives to hire exceptional, innovative and passionate individuals who want to grow with us. If you want to be part of an inclusive, adaptable, and f...
autocadcommissioning3d modellingit servicesad migrationmusic makingdata servicesaccess controlshell scriptingasmeastmidentityaccess managementReq ID:130189 NTT DATA Services strives to hire exceptional, innovative and passionate individuals who want to grow with us. If you want to be part of an inclusive, adaptable, and f...
autocadcommissioning3d modellingserver osit servicesdata serviceswindows serveractive directorynetwork securitybusiness processdomain controllerasmeastm* Expert in Active Directory and Microsoft systems and associated components. * -Large Enterprise Active Directory Design experience (greater than 30 Domain controllers) spanning multiple loc...
group policywindows serverproblem solvingactive directorydisaster recoveryenterprise networkdnsldapsamldesignwindowssecuritybusinessSRE - Infra Developer - Devops Description Responsible for the design, development, testing, integration, operation and support infrastructure services that meet stated business req...
software development life cycleapplication programming interfacescode reviewdata modelsreference datarisk managementdata managementteam developmentagile developmentbudget managementfinancial controlactive directory architect in chennai Active Directory Design understanding,Windows Server 20122016, PowerShellScripting & command experience, Domai...
windows serveractive directoryldaptrustdesignwindowscommandGroup PolicyWSUSBackup ExecActive directory architectHyperV5- 8 years of Strong programming skills in C, C++, data structures/algorithms with file system protocol development. Strong understanding of SMB protocol knowledge, samba, distributed file system. I...
javaenvironmentsql serversqlfile systemanalytical skillsagile developmentauthentication protocolsTechnical LeadAre you an expert when it comes to tools like Windows Server Operating System Do you have a track record of influencing senior IT stakeholders and business partners Do you have proven ability to sol...
active directorywindowsdhcpdnstroubleshootingsoftware development toolswindows system administrationit supportSystem Administrator* About Us Morgan Stanley is a leading global financial services firm providing a wide range of investment banking, securities, investment management and wealth management services. The Firms...
shell scriptingtime managementproject planningwealth managementtechno functionalmanagement skillsinvestment bankingfinancial servicesnetwork engineeringsecurity managementsystems programmingHello All, Urgent Requirement!! Designation : Senior Systems Engineer Active Directory Experience : 6-12yrs Location : Pune...
server administrationremote administrationdnssystem administrationgroup policycertificate managementactive directorywindows serverroot causeoememcdata centeroptimization strategiesdcsactive directory supportrimMNC urgent 1 year contract to hire opening for Hadoop Admin - Pan india. Exp: 5+ Yrs Notice period: max 20 days Must have skills: At least 3-5 years of Relevant Hadoop administrator or Big...
hadoop administrationclouderaPosition Type : Full time Type Of Hire : Experienced (relevant combo of work and education) Education Desired : Bachelor of Computer Science Travel Percentage : role modelteam skillsonline privacyshell scriptingactive directorycomputer sciencetechnical supportoperating systemsdomain controllerstrategic planning
Corporate Compliance Technology (CCT) organization is a technology enabler building complex solutions that are centrally integrated with each business line at JPMorgan Chase with instrumental function...
javasqljavascriptsql serverjquerysoftware development life cycletest driven developmentspring bootproblem solvingtest automationanalytical skillsproduction support
* About Us Morgan Stanley is a leading global financial services firm providing a wide range of investment banking, securities, investment management and wealth management services. We advise...
troubleshootinglinuxmanagementwindows serversystem designbusiness unitswork effectivelywealth managementagile developmentinvestment bankingfinancial serviceAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
operating system administrationlinux serverservice deliverycorporate liaisonsystem administrationserver administrationtroubleshooting skillsawsdnslvmitilldapslascifslinuxcloudazurebasicsambaAs a member of our Client Services team we look first and foremost for people who are passionate around solving business problems through innovation & engineering practices. We embrace a culture of ex...
salesdeliverycustomer relationsmarketingmanagementbig dataprivate cloudcloud foundryclient servicesmachine learningtechnical designtechnical skillscapacity planningfinancial servicescareer developmentAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
redhat linuxcommunication skillssystem administrationtechnology operationsinformation technologyapplication developmentawslvmitilldapcifs24x7linuxcloudazurebasicsamba* About us: Morgan Stanley is a global financial services firm and a market leader in investment banking, securities,investment management and wealth management services. With offic...
active directorydnsdhcptroubleshootinguser groupsprivate cloudbusiness unitswealth managementsystem monitoringinvestment bankingfinancial servicessecurity protocols
Our Global Technology Infrastructure group is a team rewarded with innovators who love technology as much as you do. Together, you ll use a disciplined, innovative and a business focused approach to d...
symantec endpoint protectionapplication programming interfacesbig datadata modelscyber securityreference datarisk managementdata managementmachine learningteam development03. LDAP/IAM Specialist Experience: 4+ Years Location: Mohali Provide expert guidance, security requirements and implementation recommendations for LDAP based authentication and authorization for in ...
protocolssamlvalidationoidsecuritydesignkerberosoperatorsazureaccessldapsudocomponentsmanagementunixintegrationwindowsdesign validationaccess management© 2020 Skillindia All Rights Reserved