Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Role: Node.JS Developer Note: particularly looking for E-commerce domain background candidates. Designation: Node.JS Developer SSE Notice Period: Immediate, to 30 days/less Experience : 3-6 Ye...
data structuresproblem solvingcomputer scienceawssolrcloudazuregraspdesignlucenesearchscienceadoptiondebugginganalyticalalgorithmsdeploymentstructuresnodejsecommerceRoles and Responsibilities The Technical Architect will be responsible for successfully creating custom enterprise applications using Core Java, JSPs, Hibernate or any other ORM, Apa...
frameworkapache cxfnetfront endopen sourceweb servicesdynamo dbtechnical requirements gatheringjavamaster dataamazon rdscreative problem solvingdeliverysql servermaster data managementmanage client expectationsnew conceptsobject orientedDear Candidate, Greetings of the day! We are Hiring forElastic Service Developer Job Descriptions: Di...
pythonjavaelastic searchjiraSOE Sales is a suite of application systems geared to support users within several internal departments to process a variety of customer transactions, including equipment sales and ordering, bill paym...
open source platformsbig datacore javafront endetl toolsspring mvcopen sourcebuild toolsweb frameworkelastic searchequipment salesMain responsibilities and key activities:
The Sitecore Engineer / Snr. Developer is responsible for the design and development of the core Sitecore platform and the addition of new capabilities to it in partnership with different technology a...
gsmmsstroubleshootingnetworkingfront endweb pagessql serverweb servicesplatform designcomputer scienceweb applicationsstored procedures
Description We are seeking a talented Lead Software Engineer to help build next generation Security Analytics product from ground-up. Working with a team of engineers and architects,...
jqueryjavamvcsql serverbig datacode designteam buildingcomputer scienceframework designrestful apissaashelmlinuxclouddesigndevopsqualyssearchjenkinsAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
javajavascriptsqlcustomer relationshtmlsql serverteam handlingbusiness processadvanced analyticscommunication skillssoftware engineeringprofessional servicestroubleshooting skillsnetapisdlcsolrAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
javasapreportingapisql serverteam managementimpact assessmentprofessional servicestechnology architectureibmAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
javajavascriptsqlcustomer relationshtmlsql serverteam managementbusiness processcommunication skillssoftware engineeringprofessional servicesAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
sql serverteam managementcontent strategycommunication skillsprofessional servicesinformation architecturesqlnetapisdlcsolrcloudvisithooksdesignluceneresearchstrategysitecoreDigital Product Analyst Key Responsibilities Evaluate base Search appliance configurations and assess their implications on search results Design and apply new configurations Identify opportunitie...
jirasolrcoding experiencemanagement skillsbasicdesigncomputer scienceproduct analysisnatural language processingpythondata sciencelanguage processingtroubleshooting skillsweb developmentbusiness operationsjavaproduct managementsearch enAbout Accenture: Accenture is a leading global professional services company, providing a broad range of services in strategy and consulting, interactive, technology and operations, ...
sql serverteam managementadvanced analyticscommunication skillssoftware engineeringprofessional servicesSearch Jobs Job Description New Grad Business Summary: VMware is a global leader in cloud infrastructure and business mobility. VMware accelerates customers digital transf...
client serverwindows 10operating systemsopen sourceweb developmentkanbanmachine learningbuild automationcost reductionsecurity servicescloud computingsystem managementinspectionResponsibilities
We are having an excellent Job opportunity for one of the Indias reputed Limited Company.
Product Manager Search GB04 ( Multiple Positions) Minimum Experience : 3+ years
Working Days - Day Shift
Search Jobs Job Description New Grad Business Summary: VMware is a global leader in cloud infrastructure and business mobility. VMware accelerates customers digital transf...
computer sciencesystem managementmachine learningweb developmentcloud computingoperating systemsopen sourcecost reductiondata structureswindows 10client serverbuild automation
Sr Software Engineer
Job Locations IN-Mumbai
Requisition ID 2021-57907 Category Research & Development
Whats the role Responsibilities
Ideally:
Dear Applicants, Greetings from Sri Sai Business Solution!! Hybris Software Responsibilities
InsideView is seeking creative, highly motivated, enthusiastic engineer individuals to be part of our Hyderabad based product development team. You will work in a fast paced agile environment to build...
object oriented programmingbig datacore javadata structuresproblem solvingcomputer sciencemachine learningequipment supplyagile environmentworking experienceproduct developmentsoftware engineering Roles and Responsibilities
Position:Senior Platform Engineer
Pune(Presently Remote due to Pandemic, post that the candidate need to relocate)
About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
change managementcleaningjavasqlaccountssql serverteam managementadvanced analyticscommunication skillssoftware engineeringprofessional servicesnetapisdlcsolrclouddesignacting* Duties and Responsibilities - Serve as a product owner on the scrum team and work with engineers to deliver a quality product. Engage with a variety of stakeholders- business teams technical team to...
bankingfinancefilingmissearch engine optimizationfront enduser storiessearch enginelanding pagesadobe analyticsproduct strategymarketing automationnbfcRequisition ID: 287250 Work Area: Software-Design and Development Expected Travel: 0 - 10% Career Status: Professional Emplo...
javascriptcssjqueryhtmlmysqlcore javadata structuresdesign patternssap procurementuser interactionchange managementcontent managemententerprise softwaredocument processingapplication softwareInsideView is seeking creative, highly motivated, enthusiastic engineer individuals to be part of our Hyderabad based product development team. You will work in a fast paced agile environment to build...
sql serverjavasqlcustomer relationsjavascriptobject oriented programmingbig datacore javadata processingdata structuresproblem solvingcomputer sciencemachine learning
Roles and Responsibilities
Own what you code; own the product even the bugs you create
Come up with innovative solutions to the hurdles that confront us on a day-to-day basi...
search enginesdata warehousingpresentation skillsorganization skillsphpseoapihtml5linuxmysqldesignapachelucenesearchsphinxsoftwaredatabasecassandrapresentationspecificationsCyient is a global engineering and technology solutions company. As a Design, Build, and Maintain partner for leading organizations worldwide, we take solution ownership across the value chain to help...
shell scriptingadvanced analyticsagile developmentppaptechnology solutionsinspectionmicrosoft azuredocumentationapqpapplication securityproduct developmentapi developmentglobal engineeringSoftware Development Engineer (SDE) - RelEngg - I / Software Development Engineer (SDE) - RelEngg - II Software Development Engineer (SDE) - RelEngg - I / Software Development Engineer (SDE) - RelEngg...
apijavamysqljavascripthtmlfunctional requirementsbusiness continuity planninghigh throughputbusiness continuitylow latencyrelease engineeringconfigurcapacity planningsoftware developmentmanagement systemSoftware Development Engineer (SDE) - Intern Software Development Engineer (SDE) - Intern About the Role The role requires an engineer to be a part of the core engineering team and focus on developmen...
javascriptjavamysqlhtmlapiobject oriented programmingcore javamobile applicationssoftware developmenttechnical specificationsiosj2eenginxurbannosqlcodesdesigndevopsspringmobileSoftware Development Engineer (SDE) - QA - I / Software Development Engineer (SDE) - QA - II Software Development Engineer (SDE) - QA - I / Software Development Engineer (SDE) - QA - II About the Role...
javascriptjavamysqlhtmlapiobjecttest casesweb applicationssoftware developmentproduct requirementstechnical specificationsqtpj2eenginxurbandesignspringdrivesmanualiented programmingSoftware Development Engineer (SDE) - III / Principal Engineer (PE) - I / Engineering Manager (EM) - I Software Development Engineer (SDE) - III / Principal Engineer (PE) - I / Engineering Manager (EM...
javascriptcodesj2eenosqlcloudjavamavenapimysqlawsdesignhtmlnginxtechnical specificationssoftware developmentobject oriented programmingweb applicationsarchitectural designSwoopTalent offers Talent Data as a Service infrastructure to the Fortune 500 as a multi tenant, SaaS product. We use AI powered algorithms, machine learning and leading UX to automatically create and...
javaobject oriented designfortune 500java eej2eeproduct managementmemory managementspringcomputer sciencehibernatebig datatest driven developmentteam buildingspring mvcdata as a servicemachine learningproduct requirementsinformation retri
Lead Data Engineer - 85903 Gracenote - India Mumbai, Maharashtra ABOUT THIS JOB As a member of this dynamic and fast-paced team, you will be involved in the evolvi...
data warehousingweb servicessolution designjava eecore javajavadata structurespythonsqlspring bootsoftware development methodologiesbig datamusic makinginformaticatest driven developmentMust have Should have worked on .Net 3.5 and above (no older version) Very good knowledge of C#, ASP.Net, MVC, Web API and SQL server Good to have Knowledge of MS Azure and elastiK or Lucene se...
sql servernetjqueryjavascripthtmlsqlapiazureluceneData StructuresEmbedded CEmbedded LinuxGNU DebuggerDevice DriversVHDLLinux KernelARM ArchitectureaspnetRealTime Operating Systems* Duties and Responsibilities - Serve as a product owner on the scrum team and work with engineers to deliver a quality product. Engage with a variety of stakeholders- business teams technical team to...
bankingfinancefilingmissearch engine optimizationfront enduser storiessearch enginelanding pagesadobe analyticscomputer scienceproduct strategynbfcAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
database designdocumentationesqlbusiness strategyprofessional servicesproject administrationtechnology integrationsqlnetapirisksolrcloudagilevisitidealAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
javajavascriptsqlcustomer relationshtmlsql serverteam managementbusiness processcommunication skillssoftware engineering* Duties and Responsibilities - This role is for NLP and data-oriented product development (horizontal capability builds) but it will also require strong program management and execution skills. Techn...
bankingfinancefilingmisproof of conceptitem response theoryfront enddata miningopen sourcedata sciencedata modelingsystem designdeep learningnbfcAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
production supportsapbusiness objectdocumentationenvironmentsql serverteam managementbusiness processsoftware engineeringdefining requirements* Duties and Responsibilities - Serve as a product owner on the scrum team and work with engineers to deliver a quality product. Engage with a variety of stakeholders- business teams technical team to...
bankingfinancefilingmissearch engine optimizationfront enduser storiessearch enginelanding pagesadobe analyticsproduct strategyexternal clientsconsumer durablesnbfc* Duties and Responsibilities - This role is for NLP and data-oriented product development (horizontal capability builds) but it will also require strong program management and execution skills. Techn...
bankingfinancefilingmisproof of conceptitem response theoryfront enddata miningopen sourcedata sciencedata modelingsystem designdeep learningdata analyticsnbfcAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
javajavascriptsqlcustomer relationshtmlsql serverteam managementbusiness processcommunication skillssoftware engineeringprofessional services* Duties and Responsibilities - Serve as a product owner on the scrum team and work with engineers to deliver a quality product. Engage with a variety of stakeholders- business teams technical team to...
bankingfinancefilingmissearch engine optimizationfront enduser storiessearch enginelanding pagesadobe analyticsproduct strategyexternal clientsnbfcSoftware Engineer Duties & accountabilities:
* Duties and Responsibilities - This role is for NLP and data-oriented product development (horizontal capability builds) but it will also require strong program management and execution skills. Techn...
salesmarketingbusiness developmentretailinsuranceproof of conceptitem response theoryfront enddata miningopen sourcedata sciencedata modelingsystem designdeep learningdata analytics
Essential functions The Sr. NLP Text Mining Scientist / Engineer will have the opportunity to lead a team, shape team culture and operating norms as a result of the fast-paced natu...
machine learningpythondata analysissqlanalyticshigh performance computingnatural language processingoptical character recognitionpartial differential equationsbig datause casesopen source© 2020 Skillindia All Rights Reserved