Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Job description Magento Module Development Magento Theme Development MVC MySql PHP Jquery Ajax Knowledge of frameworks like CodeIgniter, Yii, Symphony, CakePHP, Zend etc. will be added...
mysqlmagentojavascriptphpjquerytheme developmentmodule developmentyiisvngitajaxzendcakephpsymphonyversioningcodeigniterThemesThemed EntertainmentTheme EventsThemingJob description Magento Module Development Magento Theme Development MVC MySql PHP Jquery Ajax Knowledge of frame...
mysqlmagentojavascriptphpjquerytheme developmentmodule developmentyiisvngitajaxzendcakephpsymphonyversioningcodeigniterThemesThemed EntertainmentTheme EventsTheming
Job Description Responsibilities
Hi Candidates Greetings of the day We are hiring for, UI Developer /Sr Developer/Lead-Pan India 3 - 8 years Anywhere (WFH during Covid) UI Developer /Sr Developer/Lead-Pan India...
cssui developmentweb technologiessoftware engineeringhtmljavajavascripthealth insurancetypescriptExperience: 1 - 5 years Location: Ahmedabad Education: B.E/ B.Tech/ ME/ MCA/ M.Tech / MCA / BCA Job- Type: Full Time Job Skills and Responsibility: CMS: WordPress/ Magento/ Opencart Frameworks: ...
mysqlphpjqueryjavascripthtmlwebsite creationcssyiiajaxoopssoundopencartPersonal WebsitesCustom WebsitesWebsite MonetizationBrochure WebsitesDynamic WebsitesGoogle Website Optimizerate WebsitesProficient in Core PHP & atleast worked on one major PHP frameworks (zend, cake php, symphony, drupal) Excellent database/architecture design & implementation skills Strong in development of high-en...
javaenvironmentsql serversqlcustomer relationscore phpopen sourcephp frameworksteam managementweb applicationstechnical supportclient communicationphpsdlcmysqldesigncakephpplanningsymphonymanagePHP Developer-Experienced Experience: 01-02 years Salary: 20000/ -30000/ -Per month Vacancy: 05 Keyskills: Core PHP, HTML5, CSS, JavaScript & JQuery, MySQL. Cake PHP, Codeignitor, Shop...
mysqlphpjqueryjavascripthtmlclient communicationcsszendhtml5magentocakephpshopifysymphonycodeignitercommunicationCodeIgniterLaravelSymfonye phpZend Framew
Chennai | 2 Years of relevant experience
Works independently with little direct supervision or review. Ability in requirements analysis, technical design, coding, testing and implementation. Candidate Must Mini...
ajaxjqueryhtmlphpcsshtml5apijavascriptmagentodesignmysqlsvngithubjoomlatestinghandle multiple projectsrequirements analysisclient trainingtechnical designMxicoders is looking for talented Sr. PHP Developer that possesses expert level experience in PHP. If you are skilled talented who can think out of box, please read below, ...
mysqlphpjqueryjavascripthtmlclient trainingtechnical designrequirements analysiscssapisvnajaxhtml5designgithubjoomlatestingmagentolaravel* JOB DESCRIPTION Position Title : Murex/MLC/VAR Support Department : T&O-ITT Technology Job Purpose(In a brief, specific one or two-...
root cause analysisunix shell scriptingroot causeback officemarket riskfront officerisk managementshell scriptinguser acceptancetrade processingdaily productionproduction supportrelease managementPerformance Test Engineer L2 3 to 5 Yrs Apply to this job, Performance Test Engineer L2 3 to 5 Yrs Apply to this job,...
load runnerhttphtmlscriptingMaster ClassesSymphonySolo RecitalsArt SongStringRecitalsLessonsLyricalperfmance testingperfmanceSolo PerfmancePerformance Test Lead Apply to this job, Performance Test Lead Apply to this job,...
load runnerhtmlhttploadrunnerMaster ClassesSymphonySolo RecitalsArt SongStringRecitalsLessonsLyricalperfmance testingperfmanceSolo PerfmanceGood experience in MYSQL, MariaDB, Python and shell scripting as secondary skills. Good understanding of data structures, sockets, shared memory and IPC. Atomic operations. Writing efficient code to e...
capital marketc++mysqlstldeveloperManager/Senior Manager, Commercial Analytics We are looking for Manager/Senior Manager with experience in pharma / life science, which includes which includes defining the product strategies/roadmaps...
brand launchmarket accesscustomer focuslaunch supportsales analyticsbrand positioningcommercial modelsproject managementab testing
Note : Its a Contract to Hire Role for 6 Months & confirmation based on performance in 6 months. Gender : Male/Female Industry : IT Previous Work Experience : 3 to 9 years Salary ...
master classessolo performanceangularcssjqueryperformanceart songsolo recitalsjavascripthtmlmysqlstringangular jsconfirmationsymphonyCertified Chartered Accountant / MBA Finance with 2.5 years of experience in Auditing, preferably with a background in Fraud Detection, Investigation & Prevention. As your Job- Heading suggests you wo...
salescustomer servicecustomer relationsqualitydeliveryfraud detectionfraudfinanceauditingOnline FraudCredit Card FraudIdentity FraudFraud ClaimsFraud PreventionCheck FraudBank Fraudate FraudExpertise in Core JAVA , Consuming Web Services , Google Map APIs and mobile database management. Strong knowledge of Android operating systems and coding and debugging Eclipse. Sound knowledge of...
androidjavajsonapicomweb servicesoperating systemsmapsdlcsoundmobilearcgisdatabasedebuggingServletsSwingsJava Database ConnectivitySpring DIStrutse java
Chennai | 2 Years of relevant experience
Experience: 1 - 5 years Location: Ahmedabad Education: B.E/ B.Tech/ ME/ MCA/ M.Tech / MCA / BCA Job- Type: Full Time Job Skills and Responsibility: CMS: WordPress/ Magento/ Opencart Frameworks: ...
mysqlphpjqueryjavascripthtmlwebsite creationcssyiiajaxoopssoundopencartPersonal WebsitesCustom WebsitesWebsite MonetizationBrochure WebsitesDynamic WebsitesGoogle Website Optimizerate Websites* Electromechanics/Electrotechnology, Senior Design Engineer TXT5 The Senior mechatronic designer essentially contributes to technical excellence by understanding and meeting customer needs and req...
autocadcaddrawingmodelingmechanicalnew product developmentverificationvalidationcontinuous improvement facilitationbom creationproject teamscommercial modelsWhat a Sales Manager do on day to day basis Net new business: - Understanding of company and its portfolio. Keep training yourself on different Services/applications and products - Identification o...
it service managementcustomer service managementinside salesvalue sellingaccount mininglead generationcustomer serviceasset managementsolution sellingaccount managementservice management4 6 years of experience in building technology products on open source technology Prior e-commerce domain experience Worked on scalable web based products and e-commerce sites Rich experience in LAM...
mysqlmagentojavascriptphpjqueryopen sourceeffective communicationsqlxmlyiicmsajaxlampzendlinuxdrupalapachejoomlawritingtrainingPHP Developer-Experienced Experience: 01-02 years Salary: 20000/ -30000/ -Per month Vacancy: 05 Keyskills: Core PHP, HTML5, CSS, JavaScript & JQuery, MySQL. Cake PHP, Codeignitor, Shop...
mysqlphpjqueryjavascripthtmlclient communicationcsszendhtml5magentocakephpshopifysymphonycodeignitercommunicationCodeIgniterLaravelSymfonye phpZend Frameware looking suitable candidates for Drupal Developer , details are mentioned below:- Required Skills and Experience on: Should have working experience on Drupal Sites 7.x or 8.x Experience in de...
gitphpjava scriptjquerydrupalcakephpsymfonylaravelcodeigniterjsonKey Work Processes : 1. Due diligence on features available in Symphony application and current status of deployment/bottlenecks 2. Benchmarking of Tanishq merchandise management processes with best ...
change managementcleaningjavasqlaccountsproduct lifecycle managementdue diligencework processesdaily operationsmanagement systemcustomer requirementsob Description: Disbursement of loans Sanctioning letters Repayment scheduling Documentation Candidate requirement: 2- 5 years of relevant experience in home loan disbursement in Domestic Hom...
salesaccountsbankingmistatlessonsstringsymphonyperformancecommunicationdisbursementrecitalsdocumentationoperationscommunication skillssolo performancemaster classesloan operationssolo recitalsart song
Roles & Responsibilities:-
Experience: 1 - 5 years Location: Ahmedabad Education: B.E/ B.Tech/ ME/ MCA/ M.Tech / MCA / BCA Job- Type: Full Time Job Skills and Responsibility: CMS: WordPress/ Magento/ Opencart Frameworks: ...
mysqlphpjqueryjavascripthtmlwebsite creationcssyiiajaxoopssoundopencartPersonal WebsitesCustom WebsitesWebsite MonetizationBrochure WebsitesDynamic WebsitesGoogle Website Optimizerate Websites
Job Description
Should have 3 -6 Years of Experience in PHP and 2-3 years in Symphony and wordpress
Strong database skills, proven experience with PHP, MYSQL, java Script, Jquery, ...
Experience: 2 - 4 years Open Position : 01 YB php developer - Youngbrainz Infotech Php Developer The post of Php Developer will involve the candidate to do the following: Roles And Capabilities E...
mysqlphpjqueryjavascripthtmlweb servicesmusic makingpersonal skillsweb applicationsdynamic websitessystem developmentmodule developmentmobile applicationsclient requirementsking experienceproject© 2020 Skillindia All Rights Reserved