Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
- Create dynamic and responsive web applications Involve in all aspects of development projects Participate in discussions and reviews Manage and maintain web sites Deliver timely projec...
mysqlphpjqueryjavascripthtmlweb applicationsdevelopment projectscssyiijavaajaxjoomlareviewssymphonyscriptingcodeigniterLAMPDHTMLRepresentational State TransferdpressDescription : We are looking for a PHP programmer with relevant experience and ability to develop complex web applications using standard frameworks and tools. Join us! Create dynamic and responsiv...
mysqlphpjqueryjavascripthtmlweb applicationsdevelopment projectscssyiijavaajaxjoomlareviewssymphonyscriptingcodeigniterLAMPDHTMLRepresentational State TransferdpressCreate dynamic and responsive web applications Involve in all aspects of development projects Participate in discussions and reviews Manage and maintain web sites Deliver timely project progress a...
mysqlphpjqueryjavascripthtmlweb applicationsdevelopment projectsyiidesignreviewscodeigniterintegrationLAMPDHTMLRepresentational State TransferColdFusionFacebook APIsymphonyJunior PHP Developer Brief description : Designation: Junior / Software Engineer Experience: 1+ yrs Location: Calicut Minimum Qualification: BE / BTech , MSc / MCA , PGDCA or any equivalent degre...
javasqljavascriptsql serverjquerybug fixingphpcssyiihtmlajaxoopszendmysqlpgdcadesignlaravelcakephped proceduresking experiencePosition:Web Engineer III The ideal candidate for this position should possess a good understanding of enterprise-class IT development methodo...
htmlcssjavascriptjquerymysqlsoftware development life cyclelife cycleunit testingdata modelingit developmentweb developmentsolution designdesign patternsweb applicationscommercial modelsproduction supportWEB DEVELOPER (Urgent Hiring) evelopment experience in CMS: WordPress/ Magento/ Opencart Experience of Magento 1.x 2.x themes and extension development project. Worked on Magento 1.x 2.x customizati...
csshtmljavascriptjquerymysqlpayment gatewaysclient requirementsphppsdajaxdesignsalarythemesmagentotwitterfacebooksymphonyopencarteducationcommunicationPHP JD - zend framework 2, angular, mysql- This is the minimum requirement Strong Knowledge in MySQL Database. Analyse, Create and Normalize database indepe...
angularjavascriptphpzendeskpostfixzend yii symphonyzend serverzendinstallationhtml5apache serverzend frameworkbindxmlzend studioapacheajaxsmartymysqlxhtmlhtmlzend certified engineernginxdatabasezend framework 2Responsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphonyResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphonyResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphonyResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphonyResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphony4 6 years of experience in building technology products on open source technology Prior e-commerce domain experience Worked on scalable web based products and e-commerce sites Rich experience in LAM...
mysqlmagentojavascriptphpjqueryopen sourceeffective communicationsqlxmlyiicmsajaxlampzendlinuxdrupalapachejoomlawritingtrainingResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphonyResponsible for smooth operation of the floor assigned.Responsible for the performance of floor boys. Supervise Room Attendants. Organises and facilitates the room ma...
performancelessonssolo performanceart songlyricalmaster classesrecitalssolo recitalsstringsymphony
Job Description Expert knowledge in PHP, MYSQL, Ajax, JQuery, MongoDB, Node.js and JavaScript. FrameWork Experience - CodeIgnitor, Yii, Symphony Experience with versioning (GIT) and Project Manageme...
mysqlphpjqueryjavascripthtmlopen sourceproject managementapplication programmingyiicmsajaxsoapjsonrestmobilejoomlamagentomongodbnodejsdpressPHP JD - zend framework 2, angular, mysql- This is the minimum requirement Strong Knowledge in MySQL Database. Analyse, Create and Normalize database indepe...
angularjavascriptphpzendeskpostfixzend yii symphonyzend serverzendinstallationhtml5apache serverzend frameworkbindxmlzend studioapacheajaxsmartymysqlxhtmlhtmlzend certified engineernginxdatabasezend framework 2Golden Job Oppertunity for Sr. Software Engineer(PHP) @ Ahmedabad - TOPS Technologies Request a Call back Golden Job Oppertunity for Sr. Software Engineer(PHP) @ Ahmedabad April 23 , 2013 We are TOPS ...
front endtest casesit trainingdetail designshopping cartaudio masteringcontent managementfunctional requirementsphpsqlcrectchtmlzendmailtopsRoles and Responsibilities
* Job Purpose (In a brief, specific one or two-sentence statement, answer the questions: Why does this position exist and What is it expected to accomplish ) ITT (Investment Trading Tec...
javajavascriptsqlcustomer relationshtmlroot cause analysisunix shell scriptingit supportroot causeback officemarket riskfront officerisk managementshell scriptingRoles and Responsibilities
Roles and Responsibilities
Measuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
master classescomponentspumpspreventive maintenanceinterior trimnvhevaluationsolo performanceassembliesinspectionmechanicalhevchassissteeringpassive componentssafetystampingperformancesymphonyMeasuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
hevsteeringsolo performancestampingmechanicalmaster classesevaluationassembliesinterior trimcomponentsperformancechassissafetyinspectionpassive componentsnvhcommissioningsitesymphonyMeasuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
master classescomponentspumpspreventive maintenanceinterior trimnvhevaluationsolo performanceassembliesinspectionmechanicalhevchassissteeringpassive componentssafetystampingperformancesymphonyMeasuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
hevsteeringsolo performancestampingmechanicalmaster classesevaluationassembliesinterior trimcomponentsperformancechassissafetyinspectionpassive componentsnvhcommissioningsitesymphonyMeasuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
master classescomponentspumpspreventive maintenanceinterior trimnvhevaluationsolo performanceassembliesinspectionmechanicalhevchassissteeringpassive componentssafetystampingperformancesymphonyMeasuring the performance of mechanical components, devices. maintaining and modifying equipment using computer-aided design/modelling software-Solidworks producing and implementing designs and test p...
hevsteeringsolo performancestampingmechanicalmaster classesevaluationassembliesinterior trimcomponentsperformancechassissafetyinspectionpassive componentsnvhcommissioningsitesymphonyExperience :Minimum 3 years of experience in the respective field. We are looking for Senior Php developers for the consulting division of Kolkata, India. The appointed candidate will be reporting to ...
javasqljavascriptsql serverjqueryweb application securitylife cycledata modelingweb applicationcommercial modelsapplication securityrequirements analysisproject administrationoptimization strategiesperSr Software Engineer (Web) Location : Kolkata Qualification : B.Tech / MCA Experience :Minimum 3 years of experience in the respective field. We are looking for Senior Php developers for the consultin...
javasqljavascriptsql serverjqueryweb application securitylife cycledata modelingweb applicationcommercial modelsapplication securityrequirements analysisproject administrationoptimization strategiesper
Job Title : Senior Software Engineer Department : Systems Infrastructure
Main skill set - java, spring, hibernates, javascript,Sql Skills Required: Spring framework 2.2+, Struts, Hibernate (ORM), Ext JS or any other Java script frameworks, MSSQL and SQL query language, X...
hrmsbirtjspjavaimplementation planningsqlspringmysqlspring frameworkhibernatevisioxmlxslstrutsext jsNote : Its a Contract to Hire Role for 6 Months & confirmation based on performance in 6 months. Gender : Male/Female Industry : IT Previous Work Experience : 3 to 9 years Salary ...
master classessolo performanceangularcssjqueryperformanceart songsolo recitalsjavascripthtmlmysqlstringangular jsconfirmationsymphonyField managers perform regular performance evaluations of all field employees. They generate reports addressing any issues and highlighting the strengths and weakness of each member of the field team....
salesnew hire orientationssuccession planningmarketingdeferred compensationtargetworkforce planningbusiness developmentdescription developmentreportingmaster classessolo recitalsonboardinghr policiesperformancesolo performancesymphonyField managers perform regular performance evaluations of all field employees. They generate reports addressing any issues and highlighting the strengths and weakness of each member of the field team....
salesnew hire orientationssuccession planningmarketingdeferred compensationtargetworkforce planningbusiness developmentdescription developmentreportingmaster classessolo recitalsonboardinghr policiesperformancesolo performancesymphonyField managers perform regular performance evaluations of all field employees. They generate reports addressing any issues and highlighting the strengths and weakness of each member of the field team....
salesnew hire orientationssuccession planningmarketingdeferred compensationtargetworkforce planningbusiness developmentdescription developmentreportingmaster classessolo recitalsonboardinghr policiesperformancesolo performancesymphonyField managers perform regular performance evaluations of all field employees. They generate reports addressing any issues and highlighting the strengths and weakness of each member of the field team....
salesnew hire orientationssuccession planningmarketingdeferred compensationtargetworkforce planningbusiness developmentdescription developmentreportingmaster classessolo recitalsonboardinghr policiesperformancesolo performancesymphony
Job Description
Should have 3 -6 Years of Experience in PHP and 2-3 years in Symphony and wordpress
Strong database skills, proven experience with PHP, MYSQL, java Script, Jquery, ...
Field managers perform regular performance evaluations of all field employees. They generate reports addressing any issues and highlighting the strengths and weakness of each member of the field team....
salesnew hire orientationssuccession planningmarketingdeferred compensationtargetworkforce planningbusiness developmentdescription developmentreportingmaster classessolo recitalsonboardinghr policiesperformancesolo performancesymphonyField managers perform regular performance evaluations of all field employees. They generate reports addressing any issues and highlighting the strengths and weakness of each member of the field team....
salesnew hire orientationssuccession planningmarketingdeferred compensationtargetworkforce planningbusiness developmentdescription developmentreportingmaster classessolo recitalsonboardinghr policiesperformancesolo performancesymphonyField managers perform regular performance evaluations of all field employees. They generate reports addressing any issues and highlighting the strengths and weakness of each member of the field team....
salesnew hire orientationssuccession planningmarketingdeferred compensationtargetworkforce planningbusiness developmentdescription developmentreportingmaster classessolo recitalsonboardinghr policiesperformancesolo performancesymphonyField managers perform regular performance evaluations of all field employees. They generate reports addressing any issues and highlighting the strengths and weakness of each member of the field team....
salesnew hire orientationssuccession planningmarketingdeferred compensationtargetworkforce planningbusiness developmentdescription developmentreportingmaster classessolo recitalsonboardinghr policiesperformancesolo performancesymphonyField managers perform regular performance evaluations of all field employees. They generate reports addressing any issues and highlighting the strengths and weakness of each member of the field team....
salesnew hire orientationssuccession planningmarketingdeferred compensationtargetworkforce planningbusiness developmentdescription developmentreportingmaster classessolo recitalsonboardinghr policiesperformancesolo performancesymphonyNetwork administratorsare responsible for maintaining computernetworksand solving any problems that may occur with them. Typicalresponsibilitiesof th...
stringmaster classesperformanceart songsolo recitalssolo performancelessonsmonitoringlyricalrecitalssymphony
Roles & Responsibilities:-
ob Description: Disbursement of loans Sanctioning letters Repayment scheduling Documentation Candidate requirement: 2- 5 years of relevant experience in home loan disbursement in Domestic Hom...
salesaccountsbankingmistatlessonsstringsymphonyperformancecommunicationdisbursementrecitalsdocumentationoperationscommunication skillssolo performancemaster classesloan operationssolo recitalsart songPeople are at the heart of our strategy A family-owned Group, Roquette offers a positive and attractive work and career environment, in which everyone can learn, ...
product flowperformance reviewsprogressprocurementproject managementsupply planningsupply chainsiteproduction planningdemand planningpurchase orderscustomer relationsplanning scheduling
Roles and Responsibilities
Lotus Notes specialist - view details Skill / technology / Experience : Lotus Notes Administration Experience, Worked in Production support for Customer. Support Engineer background is preferred...
lotus notes administrationlotus noteslotus dominoclpmcselotusadministrationSametimeLotusScriptLotus TravelerLotus DominoLotus SymphonyXPagesQuickrproduction suppmula LanguageLotus Domino Administ© 2020 Skillindia All Rights Reserved