Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
The Brand Manager will work directly with the companys Business Heads in driving the success of new initiatives and brands. This role includes elements of marketing, project and event management, sale...
brand awarenessnew store set upnew businessstandard operating proceduressalessocial mediacustomer serviceadvertisingatldigital mediaevent managementonline salesbrand managementmarketingoffsite eventsMarket Research Analyst Experience : 1 2 Yrs Responsible for doing research on an assigned topic, and providing analysis and reporting. While the domain of knowledge will vary greatly across indus...
roiresearchtestssalespopemailchatgapmarketingfitwhite papersfile transfersecondary researchresearch analysismarket researchgap analysisCoverfox (www.coverfox.com) founded in 2013, is a tech-based insurance broking firm taking a digital-first approach to the business of insurance aggregation. Our success mantra is disr...
solution salesinsurance brokingpartner developmentbusiness developmentb2cfitbfsisalesloansbasicbuyingfinancebrokingbusinessstrategyplanninganalysisThis is a newly created role, wherein the incumbent will work closely with the Founders to launch new brands in the personal care/ skin care space or in other categories. - The role will encompass tak...
salesmerchandisingbuyingmarketingpromotion planningskin careproduct designbrand strategybusiness growthconsumer insightsbrandingidentity marketing* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about much mor...
salesmanagementmiscustomer relationsqualityquality of servicemarket shareservice deliverycustomer centricquality assurancecall calibrationWork from Office Need 200 candidates for Voice process Process Lead generation Process Product : Have to explain Benefits of Insurance Shift Time : US shift 7:30Pm to 4:30Am Saturday Sunday Fix O...
demand generationjoiningsalarysoftware industrylead generationbenefitsbarmarketing automationlead scoringlocal searchbonusonline lead generationmax10kinsuranceincubationcost per leadcomeducation 01) Identify and select potential incubateesstartups for the incubation program
02) Analyze financial statements, forecasts and funding requirements of each potential startup
03) Assist star...
Responsibilities: Excel existing and build new relationship with CSPs like AWS, Azure, GCP and others and drive CSP specific accreditations Build and lead Go-To-Market (GTM) strategy for CSP specific ...
cloud securitysecurity servicesbusiness developmentemerging technologiescehawsgtmgcpcspcismietfgciagcihsalesexcelcloudcisspazurecsacisAzure Global Commercial Industry group focuses on building the Azure capabilities for key industry verticals likeRetail and Consumer Goods, FSI,Entertainment,Energy,etc. to...
program managementleadership skillspeople leadershipconsumer goodsuser experiencedeliverycustomer focuspeople managementcustomer supportmanagementproject managementagileResponsibilities: Excel existing and build new relationship with CSPs like AWS, Azure, GCP and others and drive CSP specific accreditations Build and lead Go-To-Market (GTM)...
cloud securitysecurity servicesbusiness developmentemerging technologiescehawsgtmgcpcspcismietfgciagcihsalesexcelcloudcisspazurecsacisJob Category: Engineering Support Primary Location: Mumbai, MM IN Other Locations: India, Bangalore Job Type: Experienced Hire Hardware ArchitectJob Description R...
use casesmarket analysison locationpower deliverydata centersignal integritymechanical designkey performance indicatorsproblem solvingcomputer hardwareSystems Development Engineer(SQL SERVER DBA, Linux, Virtualization) Our customers system requirements are usually highly complex. Bringing together hardware, software, and database/application...
ms sqlwhite papersms sql serverproduct developmentsql serverdocumentationppapequal employment opportunityapqpinspectioneuropean works councilsmicrosoft sql serverwindows ossql server dbaBuilding on Azure s success as a horizontal platform, Azure Global is driving industry-specific conversations with our customers helping them digitally transform their vertically specialized customer ...
open sourcelife cyclemicrosoft azureweb servicesproduct qualitysupply chaincloud computinglarge scale systemsoil gasmedia entertainmentJob Summary This career opportunity is within our Banking, Financial Services and Insurance (BFSI) Consulting business unit. This is an India-based role to lead our Insurance consulting practice in AP...
customer experienceagileautomationbusiness analysisnew business opportunitiesclient sidenew businessthinking bigbusiness casepersonal driveproblem solvingcareer planningWork from Office Need 200 candidates for Voice process Process Lead generation Process Product : Have to explain Benefits of Insurance Shift Time : US shift 7:30Pm to 4:30Am Saturday Sunday Fix O...
demand generationjoiningsalarysoftware industrylead generationbenefitsbarmarketing automationlead scoringlocal searchbonusonline lead generationmax10kinsuranceincubationcost per leadcomeducationAre you passionate about delivering great customer experiences powered by deep understanding of user needs & data Do you want to revolutionize the way enterprises manage their risks ...
mapmanagement skillsinvestment decisionseffective communicationproduct managemententerprise riskriskdeliverytechnical requirementsagileenterprise risk managementprogram managementcomputer sciencedistributed teamsbudgetingrisk managementmanExperience : 8 to 10 years About the Role: Are you a Lawyer with an expert in transaction documentation, corporate laws Having an interest in legal research and can lead the team Then this may be a ...
bankingforeign exchange managementreportingfinancecompanies actteam leadingcompliancelegal aspectsrisklegal researchdue diligencecontract actPurplle Group is one of the largest Technology-Driven Platform/Ecosystem for Incubating and Accelerating New Age Digital First Brands in Beauty and Personal care. We have incubated 5 brands and inves...
salesmarketingbusiness developmentretailtargetnew ageprivate brandsdistribution systembrandcapitalsequoiabusinessincubationstructuresdistributionParanormalecommercedecisionmakingThis role will be pivotal to drive our Trade Finance Fraud prevention solutions by leveraging AI & ML, incl. anomaly detection, network analytics & other ML disciplines. Strategy
Position - Technical Lead (Ruby on Rails) Experience - 5 - 11 years Location - Gurgaon (Currently wfh) Working Days - 5 Industry - Ed-tech Ideal Candidate Profile : - A technology leader with 7 to 11 ...
javaenvironmentsql serversqlleadershipengineeringConsumer SoftwareEarly Stage CompaniesVirtual GoodsMobile MediaUser Generated ContentIncubationOnline MarketplaceThe Brand Manager will work directly with the companys Business Heads in driving the success of new initiatives and brands. This role includes elements of marketing, project and event management, sale...
new businessdigital mediabrand managementatlnew store set upsocial mediaonline salesadvertisingmarketingsalesbrand awarenessstandard operating proceduresoffsite eventsThe Modern Communications Customer Success Manager is a new role in our Customer Success organization that is focused on the architecture, planning, enablement, and usage of Microsoft Modern Communica...
intelligent networksbusiness processkey performance indicatorstechnical skillstechnical presentationsbusiness transformationmicrosoft solutionsunified communicationscapability buildingcustomer supportCompany - Whitehat Jr A rare opportunity for a passionate, entrepreneurial individual to join Whitehat Jr, part of Byju- s, the worlds largest Ed-tech valued at USD 12B. Responsibilities: - The leader...
key metricsuser experienceequipment supplycustomer experiencemanagement consultingProcess Excellence, Business Excellence, Process improvement, Business Transformation through Lean Six Sigma, Location - Bangalore and Kolkata Min exp: 14-23 yrs Domain: Healthcare domain, US health,...
six sigma black beltlean six sigmaidentifying new opportunitiesnew agesix sigmablack beltlife cycleproblem solvingpost productiontime managementJOB SUMMARY - Design the comprehensive brand positioning and consumer mapping and lead development of launch strategy and brand assets to drive consumer acquisition - Creation of ATL and BTL assets wi...
market researchbusiness growthbrand activationlead developmentconsumer insightsbrand positioningexternal agenciesproduct developmentbrand communicationcontinuous improvementcompetitive strategiesPractice Lead/Director - Health Sector Start-Ups - Social Incubation A mid-career individual who is passionate about social impact, has strong business acumen with a bias for action to run its incuba...
business developmentbpohiringitesnetbias for actionstrong business acumennew business developmentnew businesspublic healthsocial impactbusiness acumenequipment supplyimpact investing 01) Identify and select potential incubateesstartups for the incubation program
02) Analyze financial statements, forecasts and funding requirements of each potential startup
03) Assist star...
Job summary Amazon.com, Inc. (NASDAQ:AMZN), a Fortune 500 company based in Seattle, opened on the World Wide Web in July 1995 and today offers Earths Biggest Selection. Amazon.com, Inc. seeks to be Ea...
marketingbuild strong relationshipscontinuous improvement facilitationsalesback officecustomer relationsfortune 500hr operationspositive employee relationshr processes© 2020 Skillindia All Rights Reserved